KEGG   Streptococcus thermophilus LMD-9: STER_1857Help
Entry
STER_1857         CDS       T00414                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ste  Streptococcus thermophilus LMD-9
Pathway
ste00260  Glycine, serine and threonine metabolism
ste00750  Vitamin B6 metabolism
ste01100  Metabolic pathways
ste01110  Biosynthesis of secondary metabolites
ste01120  Microbial metabolism in diverse environments
ste01230  Biosynthesis of amino acids
Module
ste_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ste00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STER_1857
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STER_1857
Enzymes [BR:ste01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STER_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABJ66982
JGI: STER1857
Position
complement(1735073..1736557)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDENNKVTASQAILQGLATDGGLFTPLTTPEVTLDFDHLKDASYQEVAKLVL
SAFLDDFTEEELDYCITNAYDDKFDTAAIAPVVKLQNHYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGVDNKIVILTATSGDTGKAAMAGFADVPETEIIVFYPKDGVSKIQELQMT
TQAGANTHVIAIDGNFDDAQTNVKRMFNDVDLREKLLTHHMQFSSANSMNIGRLVPQVVY
YVYAYAQLVKAGHIKNGDKVNFTVPTGNFGNILAAYYAGQIGVPVGKIICASNENNVLTD
FFATGTYDKKRDFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTKELMDALVTKGEYTLA
DADKGILDLFAAGFATEDETAAEIKRVYEEDKYIEDPHTAVASAVYEAYVQKTDDHTPTV
IASTASPYKFPRVAVSAVTGKDSGDDFKAVEDLHQLSGVDIPAAVDGLERAEVRHKTVVA
AADMQKAVESYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtataccaatcaacacgtgacgaaaacaataaagtaacagctagtcaggct
attcttcaaggattggcaacagatggtggcttgttcactccactgacaacacctgaagtt
actttagactttgatcacttgaaagatgcttcttaccaagaagttgctaaattagttttg
tctgctttcttggatgattttactgaagaagaattggattactgtatcacaaatgcttat
gatgataagtttgatacagctgccattgctccagtggtcaaacttcaaaaccattacaac
cttgagctttttcatggttctaccattgctttcaaagatatggcgctttcaatattgccc
tatttgctaacaacatcagctaagaaacaaggtgttgataacaagattgttattttgaca
gcgacatcaggggatactggtaaagctgccatggctggttttgcagatgtccctgaaact
gaaattattgtcttttatccaaaagatggcgtttcaaaaatccaagaattgcaaatgaca
actcaagcaggtgctaatactcatgttattgcaattgatggtaactttgatgatgcccaa
acaaatgtgaaacgtatgtttaacgatgttgatttgcgtgagaaattgttgactcatcat
atgcaattctcatcagctaactcaatgaacattggtcgtttggtaccacaagtggtttac
tatgtgtatgcctatgcgcagttggtgaaggcaggtcatatcaaaaatggggataaggtt
aacttcacagtaccaacaggaaactttggtaacatcttggcggcttactatgcaggtcaa
attggtgttccagttggtaaaataatctgtgcttctaacgaaaataatgtccttacagac
ttctttgcaacaggtacttatgacaagaaacgtgacttcaaggtaacgacaagtccttct
atggacattttggtatcttctaacctagaacgcttgattttccatctccttggtaatgat
gcggttaagactaaagagcttatggatgcgcttgtgactaaaggtgagtacactttggct
gatgcagataaaggtatccttgatttgtttgcagcgggatttgcaactgaggatgaaaca
gctgctgaaatcaaacgtgtttatgaagaagacaagtatattgaagatcctcacacagcg
gttgcctcagctgtttacgaagcatacgttcaaaagacagatgatcacacaccaacagtt
atcgcttcaacagctagtccatacaagttcccacgtgtagcggtttcagctgttactggt
aaagatagtggtgatgacttcaaggcggtagaagacttgcaccaactttcaggagtagat
atcccagctgctgtagatggacttgaacgtgcagaagttcgccataaaacagttgttgct
gcagctgatatgcagaaagcagttgagagctatcttggtgtataa

DBGET integrated database retrieval system