KEGG   Stenotrophomonas sp. WZN-1: CCR98_00685Help
Entry
CCR98_00685       CDS       T04963                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sten  Stenotrophomonas sp. WZN-1
Pathway
sten00071  Fatty acid degradation
sten00072  Synthesis and degradation of ketone bodies
sten00280  Valine, leucine and isoleucine degradation
sten00310  Lysine degradation
sten00362  Benzoate degradation
sten00380  Tryptophan metabolism
sten00620  Pyruvate metabolism
sten00630  Glyoxylate and dicarboxylate metabolism
sten00640  Propanoate metabolism
sten00650  Butanoate metabolism
sten00900  Terpenoid backbone biosynthesis
sten01100  Metabolic pathways
sten01110  Biosynthesis of secondary metabolites
sten01120  Microbial metabolism in diverse environments
sten01130  Biosynthesis of antibiotics
sten01200  Carbon metabolism
sten01212  Fatty acid metabolism
sten02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sten00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CCR98_00685
   00630 Glyoxylate and dicarboxylate metabolism
    CCR98_00685
   00640 Propanoate metabolism
    CCR98_00685
   00650 Butanoate metabolism
    CCR98_00685
  Lipid metabolism
   00071 Fatty acid degradation
    CCR98_00685
   00072 Synthesis and degradation of ketone bodies
    CCR98_00685
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CCR98_00685
   00310 Lysine degradation
    CCR98_00685
   00380 Tryptophan metabolism
    CCR98_00685
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CCR98_00685
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CCR98_00685
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CCR98_00685
Enzymes [BR:sten01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CCR98_00685
Exosome [BR:sten04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CCR98_00685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C DDE_Tnp_IS66_C
Motif
Other DBs
NCBI-ProteinID: ARZ72765
UniProt: A0A1Z2LER3
Position
158948..160243
Genome map
AA seq 431 aa AA seqDB search
MPGISMPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLGREATLSSGLSPLTPGITLQRACGTSLDSIITVANKIALGQIESGIG
GGSDTTSDVPIVYGKKLRARLLAANRAKSTGDKIRALTAGFKFSELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFNDLIAPFRGVERDNILRPDT
SLEKLATLKPAFDKVSGRGTLTAANSTPLTDGAAAVLLASEEWARAHGHEPQAYLRDAHV
SAVDFVHGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPMGRIDPDKINLLGSSLATGHPFAATGARVIATAAKQLAERGGGRALVSICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtatctccatgcccaacgctcgtcccgtcgccatcctcggtggcgtccgcatc
ccgttctgccggcagaacaccgcgtactcggatgtcggcaacctcggcatgtcggtccgt
acgctgggcgcgctggtcgaacgcttcggcctgcatggccaacagctgggtgaagtggcg
atgggtgcggtgatcaagcactccagcgactggaacctgggccgcgaagccacgctgtct
tccggcctgtcgccgctgaccccgggcatcaccctgcagcgcgcctgtggcacctcgctg
gacagcatcatcaccgtcgccaacaagatcgcgctgggccagatcgaatcgggcatcggc
ggcggttcggacaccacctccgacgttccgatcgtctacggcaagaagctgcgtgcgcgc
ctgctggccgccaaccgtgccaagagcaccggcgacaagatccgtgcgctcaccgccggt
ttcaagttctccgagctcaagcccgagttcccgggcgtggccgagccgcgcaccggcaag
agcatgggcgaccactgcgaggacatggccaaggaatggaacatctcgcgtgactcgcag
gacgagtgggcggtgtcgtcgcacaagaagctggctgccgcctatgagcgcggtttcttc
aacgacctgatcgcaccgttccgtggcgtcgagcgtgacaacatcctgcgcccggatacc
tcgctggagaagctggccacgctgaagccggcgttcgacaaggtttccggccgcggcacg
ctgaccgccgccaactccacgccgctgaccgacggcgccgccgcggtgctgctggccagc
gaagagtgggcgcgcgcccacggccatgagccgcaggcctacctgcgtgacgcgcacgtc
tcggcggtggacttcgtgcatggcgaaggcctgctgatggcgccgaccgtggccgtgccg
gagatgctcaagcgcaacggcctgaccctgcaggacttcgacatctacgagatccacgaa
gccttcgccgcgcaggtgctgtgcaccctgcgcgcgtgggagagcgaggattactgccgc
aaccgcctgggcctggacgcgccgatgggccgcattgatccggacaagatcaacctgctg
ggctcgtcgctggccaccggccacccgttcgccgccaccggcgcacgcgtgatcgctacc
gcagccaagcagctggccgagcgcggcggtggccgcgcgctggtgtcgatctgcaccgcc
ggcggcatgggcgtggtggcgatcgtcgagcgctga

DBGET integrated database retrieval system