KEGG   Streptococcus salivarius 57.I: Ssal_00127Help
Entry
Ssal_00127        CDS       T02088                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ssal_00127 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ssal_00127 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ssal_00127 (thrC)
Enzymes [BR:stf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ssal_00127 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
113129..114613
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDENNKVTASQAILQGLATDGGLFTPLSTPEVTLDFDQLKDASYQEVAKLVL
SAFLDDFTEEELDYCITNAYDDKFDIAAIAPVVKLKNHYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKIQELQMT
TQTGANTHVIAIDGNFDDAQTDVKRMFNDVDLREKLLAHHTQFSSANSMNVGRLVPQVVY
YVYAYAQLVKAGHIQNGDKVNFTVPTGNFGNILAAYYARQIGVPVGKLICASNENNVLTD
FFATGTYDKKRDFKVTTSPSMDILVSSNLERLIFHLLGNDSTKTKELMDALVTKGEYTLA
DADKDILDLFAAGFATEDETAAEIKRVYDEDKYIEDPHTAVASAVYEAYVQKTDDHTPTV
IASTASPYKFPRVAVSAVTGKDSGDDFKAVEDLHQLSGVAIPAAVDGLEHAEVRHKTVVA
AADMQKAVESYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtataccaatcaacacgtgacgaaaataataaagtaacagctagtcaggct
attcttcaaggtttggcaacagatggtggcttgttcacaccattgtcaacgcctgaggtt
actttggactttgatcaattgaaagatgcttcttaccaagaagttgctaaattggtcttg
tcagctttcttggacgattttactgaagaggaattggattactgtatcacaaatgcttat
gatgacaagtttgatatagctgccattgcaccagtagttaaacttaagaaccactacaat
cttgaacttttccatggttctactattgctttcaaagatatggccctttcaatcttgcca
tacttgctaacaacatcagctaaaaagcaaggtgttgataataagattgtcatcttgaca
gcgacatcaggtgacactggtaaggctgctatggctggttttgcagatgttcctggaact
gaaatcattgtcttttatccaaaagacggtgtttcaaaaatccaagaattgcaaatgacc
actcaaacaggagctaatactcacgttattgccattgatggtaactttgatgatgcccaa
acagatgtgaaacgtatgtttaatgatgttgatttgcgtgagaaattgttagctcatcat
acgcaattctcatcagctaactcaatgaacgttggtcgtttggtaccgcaagtggtttac
tatgtatatgcctatgcacagttggttaaggcaggtcatatccaaaacggagataaggtg
aacttcacagtaccaacaggaaactttggtaatatcttggcggcttattatgcacgtcag
attggtgttccagttggcaaattaatctgtgcttctaatgaaaataacgtccttacagac
ttcttcgcaacgggtacttatgacaagaaacgtgacttcaaggtaacaacaagcccttct
atggatatcttggtatcttctaacttggaacgcttgattttccaccttcttggtaatgat
tctactaagactaaagagcttatggatgcacttgtgactaagggtgagtatactttggct
gatgcagataaagatattcttgatttgtttgcagcaggttttgcaactgaggatgaaaca
gctgctgaaatcaagcgtgtctatgatgaagacaagtatatcgaagatcctcatacagca
gttgcctcagctgtttacgaagcatatgttcaaaagacagatgaccacacaccaacagtt
atcgcttcaacagctagcccatacaaattcccacgtgtggctgtttcagctgtcactggt
aaagacagtggggatgatttcaaagcagtagaagatttgcaccaactttcaggtgtagct
atcccagcggctgtagatggacttgaacatgcagaagttcgccataaaacagttgttgcg
gcagctgatatgcaaaaagcagttgaaagctatcttggtgtataa

DBGET integrated database retrieval system