KEGG   Streptococcus salivarius 57.I: Ssal_00127Help
Entry
Ssal_00127        CDS       T02088                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00260  Glycine, serine and threonine metabolism
stf00750  Vitamin B6 metabolism
stf01100  Metabolic pathways
stf01110  Biosynthesis of secondary metabolites
stf01120  Microbial metabolism in diverse environments
stf01230  Biosynthesis of amino acids
Module
stf_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ssal_00127 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ssal_00127 (thrC)
Enzymes [BR:stf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ssal_00127 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEJ52549
UniProt: F8HEK1
Position
113129..114613
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDENNKVTASQAILQGLATDGGLFTPLSTPEVTLDFDQLKDASYQEVAKLVL
SAFLDDFTEEELDYCITNAYDDKFDIAAIAPVVKLKNHYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKIQELQMT
TQTGANTHVIAIDGNFDDAQTDVKRMFNDVDLREKLLAHHTQFSSANSMNVGRLVPQVVY
YVYAYAQLVKAGHIQNGDKVNFTVPTGNFGNILAAYYARQIGVPVGKLICASNENNVLTD
FFATGTYDKKRDFKVTTSPSMDILVSSNLERLIFHLLGNDSTKTKELMDALVTKGEYTLA
DADKDILDLFAAGFATEDETAAEIKRVYDEDKYIEDPHTAVASAVYEAYVQKTDDHTPTV
IASTASPYKFPRVAVSAVTGKDSGDDFKAVEDLHQLSGVAIPAAVDGLEHAEVRHKTVVA
AADMQKAVESYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtataccaatcaacacgtgacgaaaataataaagtaacagctagtcaggct
attcttcaaggtttggcaacagatggtggcttgttcacaccattgtcaacgcctgaggtt
actttggactttgatcaattgaaagatgcttcttaccaagaagttgctaaattggtcttg
tcagctttcttggacgattttactgaagaggaattggattactgtatcacaaatgcttat
gatgacaagtttgatatagctgccattgcaccagtagttaaacttaagaaccactacaat
cttgaacttttccatggttctactattgctttcaaagatatggccctttcaatcttgcca
tacttgctaacaacatcagctaaaaagcaaggtgttgataataagattgtcatcttgaca
gcgacatcaggtgacactggtaaggctgctatggctggttttgcagatgttcctggaact
gaaatcattgtcttttatccaaaagacggtgtttcaaaaatccaagaattgcaaatgacc
actcaaacaggagctaatactcacgttattgccattgatggtaactttgatgatgcccaa
acagatgtgaaacgtatgtttaatgatgttgatttgcgtgagaaattgttagctcatcat
acgcaattctcatcagctaactcaatgaacgttggtcgtttggtaccgcaagtggtttac
tatgtatatgcctatgcacagttggttaaggcaggtcatatccaaaacggagataaggtg
aacttcacagtaccaacaggaaactttggtaatatcttggcggcttattatgcacgtcag
attggtgttccagttggcaaattaatctgtgcttctaatgaaaataacgtccttacagac
ttcttcgcaacgggtacttatgacaagaaacgtgacttcaaggtaacaacaagcccttct
atggatatcttggtatcttctaacttggaacgcttgattttccaccttcttggtaatgat
tctactaagactaaagagcttatggatgcacttgtgactaagggtgagtatactttggct
gatgcagataaagatattcttgatttgtttgcagcaggttttgcaactgaggatgaaaca
gctgctgaaatcaagcgtgtctatgatgaagacaagtatatcgaagatcctcatacagca
gttgcctcagctgtttacgaagcatatgttcaaaagacagatgaccacacaccaacagtt
atcgcttcaacagctagcccatacaaattcccacgtgtggctgtttcagctgtcactggt
aaagacagtggggatgatttcaaagcagtagaagatttgcaccaactttcaggtgtagct
atcccagcggctgtagatggacttgaacatgcagaagttcgccataaaacagttgttgcg
gcagctgatatgcaaaaagcagttgaaagctatcttggtgtataa

DBGET integrated database retrieval system