KEGG   Streptococcus salivarius 57.I: Ssal_00175Help
Entry
Ssal_00175        CDS       T02088                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ssal_00175 (galU)
   00052 Galactose metabolism
    Ssal_00175 (galU)
   00500 Starch and sucrose metabolism
    Ssal_00175 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Ssal_00175 (galU)
Enzymes [BR:stf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ssal_00175 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(156841..157755)
Genome map
AA seq 304 aa AA seqDB search
MKNQKVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTG
KSKRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKA
FVGNEPFVVMLGDDLMDITNDKAVPLTKQLINDYEETHASTIAVMPVPHEEVSSYGVIAP
QGEGENGRYSVETFVEKPNPEDAPSDLAIIGRYLLTPEIFGILETQEPGAGNEVQLTDAI
DTLNKTQRVFAREFTGDRYDVGDKFGFMKTSIDYALKHPQIKDDLKQYLIDLGHKLEGKP
AKKD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcaaaaagttagaaaagctatcatccccgctgcaggactcggaacacgcttt
ttaccagctactaaggccttggccaaagaaatgttgccaatcgttgacaaaccaaccatc
caatttatcgttgaagaagccctcaaatcaggtatcgaagatatcttggtggttactggt
aagtcaaaacgttctatcgaagatcactttgattcaaacttcgaattagagtacaacttg
gaacaaaaaggtaagacagacttgttgaaattggttaatgataccactgctattaacctc
cactttatccgccaaagccacccacgtggccttggagatgctgttcttcaagctaaagca
tttgtcggaaatgagccatttgttgttatgcttggtgatgaccttatggatatcactaat
gacaaagctgtaccattgactaaacagctcattaacgattatgaggaaacacacgcatca
accattgcagttatgcctgtaccacacgaagaagtttcttcttatggtgtcatcgcccct
caaggcgaaggcgaaaatggacgttatagcgttgaaactttcgttgaaaaaccaaatcca
gaggatgcaccaagtgatcttgctatcatcggacgttaccttctaacacctgaaattttc
ggtattttggaaactcaagaaccaggtgctggaaacgaagtccaattgactgatgctatc
gatacgcttaacaagacacaacgcgtctttgctcgcgaatttactggagaccgttatgat
gtcggtgataaattcggattcatgaaaacatcaatcgattacgcacttaaacatcctcaa
attaaagatgacctcaagcaatacctcattgacttgggtcacaaacttgaaggcaaacca
gctaaaaaagactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system