KEGG   Streptococcus salivarius 57.I: Ssal_00191Help
Entry
Ssal_00191        CDS       T02088                                 

Gene name
gltX1
Definition
glutamate--tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:stf00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
170406..171860
Genome map
AA seq 484 aa AA seqDB search
MAKDIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFIIRIEDTDRKRHVEDGERSQL
DNLRWLGIDWDESPETHENYRQSERLPLYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEFLGMTEEEKAAYIAEREAAGIVPTVRLAVNESGIYKWHDIVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYLPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDENRLSKSPAAFDQKKLDWMSNDYIKNADFDKVFALCKPFLEEAGRLTDKAEK
LVELYKPQMTAAEEIVPLTNLFFEDFPELTEAEKEVMAGETVPTVLKAFKAKLEAMSDDE
FVVENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIFLLGREKSIKHIDQV
LATL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttggctaaagatatccgcgttcgttacgcaccaagtccaacagggcttctacacattggt
aatgctcgtacagcattgtttaactacctttatgcacgtcatcatggtggtacattcatt
atccgtattgaagatactgaccgtaaacgtcacgttgaagatggtgagcgttcacagctt
gataacttgcgttggttgggaattgactgggatgaaagtcctgagacacacgaaaactat
cgtcaatcagagcgtttgccactttaccaaaaatatattgatcaacttttggcagaaggt
aaagcctataagtcatatgtcactgaagaagagttggctgcagagcgcgaacgtcaagaa
gcggctggtgaaactcctcgttacattaacgagttccttggcatgactgaagaagaaaaa
gctgcctacatcgcagaacgtgaagcagcaggtattgtacctacagttcgtttggcggtt
aatgagtcaggaatttataaatggcatgatatcgttaagggagatatcgaatttgaaggt
ggtaatatcggtggtgactgggttatccagaagaaagatggttacccaacttacaacttt
gcggtagttgttgatgatcacgatatgcaaatttcacacgttatccgtggagatgaccat
attgccaatacaccaaaacaactcatggtttatgaagctcttggttgggaagctcctgag
tttggacacatgactcttatcatcaattctgaaactggtaagaagttgtctaaacgtgat
actaacacccttcaatttatcgaagattaccgtaaaaaaggttaccttccagaagcagtc
tttaacttcattgctcttcttggttggaatcctggcggtgaagacgaaatcttttctcgt
gaagaactcattaaactttttgatgaaaaccgtctaagcaagtcaccagcggcctttgac
cagaagaaattggattggatgagtaacgactacattaagaatgcagatttcgataaggtc
tttgctctttgcaaacctttcttggaagaagctggtcgtttgacagataaagctgagaaa
ttagtggaactctataaaccacaaatgacagctgcagaagaaattgtccctcttacaaat
ctcttctttgaagatttcccagaattgacagaggctgaaaaagaagttatggctggtgaa
acagtaccaacagtacttaaagcctttaaagccaaactcgaagctatgtctgatgatgag
tttgttgttgaaaacattttcccacaaattaaggctgttcaaaaagaaacaggaatcaaa
gggaaaaatctcttcatgccaatccgtattgctgtttcaggagaaatgcacggtccagaa
ttgccagatactattttcttgctcggtcgtgaaaaatcaatcaaacatattgatcaagtt
cttgcaacactataa

DBGET integrated database retrieval system