KEGG   Streptococcus salivarius 57.I: Ssal_00464Help
Entry
Ssal_00464        CDS       T02088                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ssal_00464 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ssal_00464 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ssal_00464 (trpB)
Enzymes [BR:stf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ssal_00464 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
415490..416698
Genome map
AA seq 402 aa AA seqDB search
MTYQQPDAKGFYGKFGGQFVPETLMTAVIELDKAYREAKEDPSFQAELDDLLKNYVGRET
PLYHAKRLTDHIGGAQIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMDCTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVAGIEDTHYIMGSALGPAPFPEIVRDFQSVIGREAKRQYAEISGGKLPDAVMACIGGGS
NAIGMFYPFVNDKSVAMYGAEASGLGLDTEKHAATFAKGRPGILHGALMDVLQDAHGQIM
EAFSISAGLDYPGVGPEHCYFNEIGRATYDSITDEEALEGFKLLSRLEGIIPALESSHAI
ALAQKVAAKMSPDQSLIVCLSGRGDKDVMQVKERFEAEAEGK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaacaacctgatgcaaaaggattttacggaaaattcggtggtcagttcgtt
ccagaaacgctgatgacagctgttattgaattggacaaggcctatcgtgaagccaaggag
gatccaagtttccaagcggaattggatgatctcctcaaaaactatgtgggccgtgagacg
ccactttaccacgccaaacgtttgactgatcatatcggtggagcgcaaatttatcttaaa
cgtgaggaccttaaccacacaggtgcccacaagattaacaatgcccttggtcaagtcttg
cttgccaaacgtatgggcaagaagaaaatcatcgccgaaacgggtgcaggtcaacacggt
gttgcaacagcgacagccgcagcccttttcgacatggattgtacgatctatatgggtgag
gaagatgttaaacgtcaggcgcttaacgttttccgtatggagttgcttggtgccaaggta
tttagcgtaacagatggttcgcgcgtgcttaaggacgctgtaaatgctgcccttcgtgct
tgggttgcaggtatcgaggatacgcactatatcatgggatctgcccttggtcctgcaccg
ttcccagaaattgttcgtgacttccaatctgtcatcggtcgtgaagccaaacgccaatat
gcagagatttctggtggtaaattgcctgatgctgtaatggcttgtatcggtggtggttca
aatgctatcggtatgttctacccatttgttaatgataaatcagtagccatgtatggtgct
gaggcttctggtttggggcttgatactgaaaaacatgccgcaacctttgccaaaggtcgt
cctggtatccttcatggagcgcttatggatgttctccaagatgctcatggtcaaatcatg
gaagccttctctatctcagctggtctggactacccaggggttggtcctgagcactgttat
ttcaacgaaattggacgtgcgacttacgactctatcacagacgaagaagctcttgaaggc
ttcaaacttctgtcacgtttggaaggtattatcccagctcttgagtctagccatgccatt
gcgcttgcgcaaaaagtggcagctaagatgtcgccagaccaaagcctcatcgtctgcctc
tcaggtcgtggggacaaggacgttatgcaggttaaagaacgtttcgaagctgaagcagaa
gggaaataa

DBGET integrated database retrieval system