KEGG   Streptococcus salivarius 57.I: Ssal_00521Help
Entry
Ssal_00521        CDS       T02088                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ssal_00521 (folE)
Enzymes [BR:stf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Ssal_00521 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471208..471786
Genome map
AA seq 192 aa AA seqDB search
MQEEIMANQEKVEQAVYQLLEALGENPEREGLLDTPKRVAKMYAEMFSGLNEDPKDQFTA
VFSEVHDEVVLVKDIPFYSMCEHHLVPFYGKAHVAYLPSGDKVTGLSKLARAVEVAARRP
QLQERLTDQVATALEEALNPRGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGLYKEDRE
ERKEILSLMRDF
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagaggaaattatggcaaatcaagaaaaagtagaacaagcagtctatcaactattg
gaagctctaggtgaaaatcctgagcgtgagggacttttggacacaccaaaacgtgtggct
aagatgtatgctgaaatgttttcaggtctaaatgaagaccctaaggatcaatttacagct
gtcttttcagaagtccatgacgaagttgtccttgtcaaggatattcctttttactctatg
tgtgagcaccatttggttccattttatggtaaggcccacgtggcttatttgccaagtgga
gacaaggtgacaggactttccaaattagcgcgtgcggttgaagtagctgctcgtcgtccg
cagttgcaagaacgtcttacagatcaagttgctacagcacttgaagaagctctgaatcct
cgaggagtttttgtcatggttgaagcagagcacatgtgcatgaccatgcgaggcattaag
aaaccaggaagtaagacaatcacaactgtcgctaagggcctttataaagaagaccgtgaa
gaacgcaaggaaattctttcattgatgcgtgatttttag

DBGET integrated database retrieval system