KEGG   Streptococcus salivarius 57.I: Ssal_00525Help
Entry
Ssal_00525        CDS       T02088                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:stf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
474688..475146
Genome map
AA seq 152 aa AA seqDB search
MGDRQGYLQKAVKALNDLPETEVKAVSSYYETAAWGLTDQADFLNLALALETKLPAESLL
RSCQQIEKDLDRVRHEHWGPRTVDIDILLYGQEIWETEHLKVPHPYMSQRAFVLVPLVEI
ADDLVDPKTGQAYKNYLSQLNTSDVRKLELMD
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgggagaccgtcaaggctatcttcaaaaagctgtgaaggccttgaatgacttacctgag
acggaggttaaagcggtatcctcttattatgaaacggctgcttggggactgacagatcag
gctgattttttgaatcttgccttggctttagagacgaagttgccagctgaaagcttacta
aggtcatgtcagcaaattgaaaaagaccttgatcgcgttcgtcatgagcattgggggcct
cggacagtagatatcgatattcttctatatgggcaggaaatttgggagactgagcacctt
aaagtgccccacccttatatgagccagagagcttttgttttggtgcccttagtagaaata
gcagatgatttggttgaccccaaaactgggcaagcctacaaaaattatttgagtcaatta
aacactagtgatgtccgtaagttggagcttatggactag

DBGET integrated database retrieval system