KEGG   Streptococcus salivarius 57.I: Ssal_00654Help
Entry
Ssal_00654        CDS       T02088                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:stf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
593488..595368
Genome map
AA seq 626 aa AA seqDB search
MNLDEAMYTFGTGENFHLQNYLGVHELEGEEGFIFRVWAPHAEQIQVIGDFTGWFDEPLD
MTKNHIGVWEATSALPEEGQLYKFLVKRKGGQVVEKMDPFATYLEPRPGTGAVIRKKKTK
KWKDGLWMGRRKRFGFQKRPVNIYEAHASSWKLKEDGQPYTFKELKEELIPYLVEMNYTH
VEFMPLMAHPLGMSWGYQLMGYFAFEHTYGTPEEFQDFVEACHQNNIGVLVDWVPGHYTQ
NDDALAYFDGTPTFEYQDHDRAHNYRWGALNFDLGKNQVQSFLISSALYWIENYHIDGIR
VDAVSNMLYLDYDEGPWMPNKDGGNRNLEGYGFLQKLNREIKKRYPDVMMVAEESTAATP
ITQPIEEGGLGFDFKWNMGWMNDILKFYAEDPVYRQYDFNLMTFSFMYCFNENYVLPFSH
DEVVHGKKSMMHKMWGDRYNQFAGLRNLYAYQLCHPGKKLLFMGSEFGQFLEWKFDYQLE
WGNLEDEMNQKMQAFTSHMNAFYKDHKSLWQIDDSYDGIEIIDADNRAESVLSFIRKDDK
GDKGDFLVCVFNLAPVERQNFTIGLPVAGIYQEVLNTEMEEFGGVWKEGNPETRTQKAKW
KDYENTLSFTLPALGASIWRVKRRLK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgatgaagccatgtacacatttggaacaggtgagaacttccaccttcagaat
tatttgggtgtgcatgaattagagggagaagaaggttttatcttccgtgtgtgggcccct
catgctgagcagattcaggtaattggagatttcacaggttggtttgatgaacctctggat
atgaccaaaaaccatatcggtgtttgggaggcaacttcagctctcccagaggaaggacaa
ctctataagttcttggtgaaacgtaagggaggtcaagtcgtcgaaaagatggatcctttt
gcgacttacttagagcctcgtcctggaacaggagctgtgattcgtaagaagaaaactaag
aagtggaaggatggcctttggatgggtcgtcgtaaacgctttggtttccaaaaacgtccg
gttaatatctatgaagctcatgcatcatcttggaaactaaaagaggatggtcaaccttat
actttcaaagaattgaaagaagagttgattccatatttggttgagatgaactatacccac
gtggaattcatgccactcatggctcatcctcttgggatgagttggggttaccagcttatg
ggttactttgcttttgagcatacctatggcacaccagaagaatttcaagatttcgtagaa
gcatgtcaccagaataatatcggtgtcttggtagactgggtcccaggtcactatacacag
aatgacgatgctttggcctacttcgatggtacaccaactttcgaatatcaggatcatgat
cgagctcataactatcgttggggcgcacttaactttgacttaggaaaaaatcaagttcag
tctttccttatttcaagtgctctttactggattgaaaattatcatatcgatggtatccga
gtggatgcagtatctaacatgctctatttggactatgatgaaggtccatggatgcctaac
aaggacggtggaaatcgtaacttggaaggctacggcttccttcaaaaactcaatcgtgaa
attaaaaaacgctatccagatgttatgatggttgcggaagaatcaactgcagcaacgcca
atcacccaaccgattgaagaaggtggtctaggtttcgacttcaaatggaatatgggttgg
atgaacgatatcctcaaattctacgcagaagatccagtttaccgtcagtatgacttcaat
ctgatgaccttcagtttcatgtattgcttcaatgaaaactatgttctacctttctcacat
gatgaagtggttcatggtaagaagagcatgatgcataagatgtggggtgaccgctataat
caatttgctggtcttcgtaacctctatgcttaccaactctgtcacccaggtaagaaattg
ctctttatgggttctgagtttggtcaattcttggagtggaagtttgattatcaactcgaa
tggggtaatcttgaagatgagatgaaccagaagatgcaggcctttactagccatatgaat
gctttctacaaggaccataaatctctctggcagattgatgattcttacgatggtattgag
attatcgatgcggataaccgtgctgaaagtgttctttccttcattcgtaaagatgataaa
ggcgataagggtgacttcctcgtctgtgtcttcaacctagctccagtggaacgtcaaaac
ttcactattggattgccagtagctggtatctaccaagaagtgcttaacactgagatggaa
gaattcggtggcgtttggaaagaaggaaatcctgaaacccgtacccaaaaagcgaagtgg
aaggactatgaaaatacccttagcttcaccctacctgctctaggagcaagtatctggcgt
gtaaaacgtcgtttgaaataa

DBGET integrated database retrieval system