KEGG   Streptococcus salivarius 57.I: Ssal_00811Help
Entry
Ssal_00811        CDS       T02088                                 

Definition
peroxiredoxin Hyr1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Ssal_00811
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Ssal_00811
Enzymes [BR:stf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Ssal_00811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(815263..815739)
Genome map
AA seq 158 aa AA seqDB search
MTSLYDFTVSDQADQAVSLQDYKGKVVLIVHTATGCGLTPQYQGLQELYDKYTNQGFDIL
DFPCNQFMGQAPGSAEEINTFCTLNYHTTFPRFAKIKVNGKEAEPLFDWLKQEKSGPLGA
RIEWNFAKFLINREGQVVERFSSKTEPLKMEETIKELL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacatccttatacgattttacagtttcagatcaagctgaccaagctgtgtctctccag
gactataagggaaaggtagttctaattgttcatacagcaacaggctgtggtttgacgcca
cagtatcaaggtttgcaggaactttatgacaaatacacaaatcaaggattcgatattctt
gattttccttgtaatcaatttatggggcaggcacctggtagtgctgaagaaatcaatacc
ttctgcaccctcaattaccatactaccttccctcgttttgccaaaatcaaggtcaatggt
aaggaagcagagccactttttgattggctaaaacaagaaaaatctggaccgcttggggct
agaattgaatggaactttgctaagtttttgattaaccgtgaaggtcaagtcgtcgaacgc
ttttcttccaaaactgaaccactgaaaatggaagagactatcaaagaactcctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system