KEGG   Streptococcus salivarius 57.I: Ssal_00992Help
Entry
Ssal_00992        CDS       T02088                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ssal_00992 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssal_00992 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    Ssal_00992 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ssal_00992 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ssal_00992 (adhP)
   00626 Naphthalene degradation
    Ssal_00992 (adhP)
Enzymes [BR:stf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ssal_00992 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985719..985982
Genome map
AA seq 87 aa AA seqDB search
MTTYKTIKKAKVEPGQWVAIYGAGGLGNLAIQYAKKVFNARVVAVDINQDKLALAKESGA
DLVVNGKEVEDVAGYIQEKLVVHTVLL
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacatataagactattaaaaaagctaaagttgaaccaggtcaatgggtagctatt
tatggtgctggaggactaggtaacttggctattcaatatgctaagaaagttttcaatgct
cgagtagtggctgttgatatcaaccaagataaacttgctttggctaaggaatctggtgct
gatttagtggtgaacggtaaagaagttgaagatgtagcaggctatatccaagaaaaactg
gtagtacacacagtgctgttgtaa

DBGET integrated database retrieval system