KEGG   Streptococcus salivarius 57.I: Ssal_01115Help
Entry
Ssal_01115        CDS       T02088                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:stf00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1098171..1099670)
Genome map
AA seq 499 aa AA seqDB search
MNKRASGVLMHITSLPGDYGIGSFGQAAYDFVDFLKETKQTYWQILPLTTTSYGDSPYQS
FSAVAGNTHFIDLDFLIRDKFLTKADVKGADFGSDPEFIDYAKVYEARRPLLEKAVKAIL
ADKKEAKKFEAFKSENANWLADYADFMAIKEHFDNKALQDWDDKKAVKRDEATLEKLRKE
LADVITYHQVVQYLFFSQWAELKAYANKNGIQIIGDMPIYISADSVEVWTQPHLFKLDAE
CKPRYIAGVPPDNFSATGQLWGNPIYAWDKHKAENYAWWVFRIQESFKLYDYLRIDHFKG
FSDFWEIPGGDETAENGEWVPGPGYDLFKVVKEELGDLKIIAEDLGNIDDKTRKLLADCG
YPGMKIVQFGFYDTTGNSIDIPHVYTQHSVAYTGTHDNEVINGWYDNLTQEQRDYTDAYI
NRRQGEPITRALLRTLFATVSNTAIATMQDILDKPENSRTNFPNTVGENWKWRMLPGEIT
VDKKEFLTDITERYNRGNK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgagcaagcggtgttttgatgcacatcacatctctaccaggtgactacggg
atcggatctttcggtcaagcagcctatgactttgttgacttcttgaaagaaacaaaacaa
acttactggcagatcttgccacttactacaacaagttatggggattcaccttaccaatca
ttctcagcggtagcgggaaatactcactttatcgatttggatttccttattcgtgacaag
tttcttactaaagctgatgttaaaggcgctgactttggatcagatccagagtttatcgac
tatgctaaagtttatgaagcacgtcgcccacttcttgaaaaagcagtcaaagcaatcttg
gctgacaaaaaagaagctaagaagtttgaagctttcaaatctgagaatgctaactggtta
gcagattatgctgatttcatggctatcaaagaacactttgataacaaagcacttcaagat
tgggatgataaaaaagcggttaaacgcgatgaggcaactcttgaaaaacttcgcaaagaa
cttgctgatgtcatcacttaccaccaagtagtgcaatacctcttctttagccaatgggca
gaacttaaagcctatgctaacaaaaatggtattcaaatcattggtgacatgccaatctac
atctcagctgatagtgttgaagtttggacacaaccacacctcttcaaactagatgctgaa
tgtaaaccacgttacattgccggagttccaccagataacttctcagctactggtcaactt
tggggtaacccaatctacgcttgggataaacacaaagcagaaaactatgcttggtgggta
ttccgtattcaagaatcattcaaactttatgattacttgcgtatcgatcacttcaaaggt
ttctctgacttctgggaaattcctggtggagatgaaactgctgaaaatggtgaatgggtt
cctggacctggttatgacctcttcaaagtggtcaaagaagaattgggtgatcttaaaatc
attgccgaagaccttggtaacattgatgataagacacgtaaacttcttgcagactgtggt
taccctggaatgaagattgttcaatttggtttctacgatactactggaaacagcattgat
attccacatgtatacacacaacattcagttgcttacacaggtacacatgataacgaagta
atcaacggttggtacgacaacttgacgcaagagcaacgtgattacactgatgcttacatt
aaccgtcgtcaaggtgaaccaattacacgtgctctccttcgcacactctttgctacagta
agcaacacagctattgcgactatgcaggatatccttgataaacctgaaaatagccgtaca
aacttccctaacacagttggtgaaaactggaaatggcgtatgcttccaggtgaaatcact
gtagacaagaaagaatttttgacagacattacagaaagatataatcgaggtaataaataa

DBGET integrated database retrieval system