KEGG   Streptococcus salivarius 57.I: Ssal_01229Help
Entry
Ssal_01229        CDS       T02088                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:stf00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:stf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1215912..1217183)
Genome map
AA seq 423 aa AA seqDB search
MDKIIVQGGNTRLSGEVVIEGAKNAVLPLLAATILASEGQTTLTNVPILSDVYTMNNVVR
GLDVAVDFDEENNTVVVDASGEILDQAPYEYVSKMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGAKITQVGGDITATVENLKGATIYMDFPSVGATQNLMMAATLA
DGVTTIENAAREPEIVDLALLLNEMGADVKGAGTETLVIKGVKALHGTKHAVVQDRIEAG
TFMVAAAMTSGDVLIKDAIWEHNRPLISKLLEMGVDVKEEEGGIRVKSDVSQLKPVTVKT
LPHPGFPTDMQAQFTALMAVVNGESTMIETVFENRFQHLEEMRRMGLHSEILRDTAMIHG
GLPLQGAQVMSTDLRASAALILTGMVAEGTTTVGKLTHLDRGYYQFHEKLAKLGANISRV
SEA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattattgtgcagggtggcaacactcgattaagtggtgaggttgtcattgaa
ggtgctaaaaacgctgtcctccctttgttggcggcgactatcttggcctcggaaggtcaa
acaaccttaactaatgttccaatcttgtcagatgtttacacgatgaataatgttgttcgt
ggtttagatgttgctgtagactttgacgaggaaaacaataccgttgttgttgatgctagt
ggagaaattctcgatcaagcaccatatgagtatgttagtaagatgcgtgcatcaatcgta
gttcttggacctattcttgcccgtaatggtcacgctaaggtctcaatgcctggcggttgt
acgattggtagtcgtccaatcgacctccacctcaaaggtttggaagcaatgggtgctaaa
attacccaagttggtggtgacattactgcgacggtagaaaaccttaaaggtgcaacgatt
tatatggacttcccatctgttggtgccactcaaaaccttatgatggcagcaactttggct
gatggtgttacaaccattgaaaatgctgcgcgtgaaccagaaatcgttgacttggctctt
cttcttaacgagatgggagcagacgtcaaaggtgctggaactgaaacactcgtgattaaa
ggtgttaaagctctccatggtactaaacatgcagttgttcaggaccgtattgaagcaggt
acctttatggtagcagcggctatgacttctggagatgtcctcatcaaagatgctatctgg
gaacataaccgtcctttgatttcaaaattattggaaatgggtgttgatgttaaggaagaa
gaaggtggcattcgtgttaaatctgatgtttctcaattgaaaccagtaaccgttaaaact
ctacctcacccaggtttcccaactgacatgcaggctcaatttacagcacttatggcagtg
gtaaacggtgaatcaaccatgattgaaactgtctttgagaatcgcttccaacacttggaa
gaaatgcgtcgtatgggacttcattcagaaattcttcgtgatacggctatgattcacggt
ggtttgccacttcaaggtgctcaagttatgtctactgaccttcgagcttcggcagcactt
attcttacaggaatggtggctgaaggaacaacgactgttggtaaattaactcacttggat
cgtggttactatcaattccatgagaaactagctaaactaggagcaaatatttcacgtgta
agtgaggcttag

DBGET integrated database retrieval system