KEGG   Streptococcus salivarius 57.I: Ssal_01270Help
Entry
Ssal_01270        CDS       T02088                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stf  Streptococcus salivarius 57.I
Pathway
stf00010  Glycolysis / Gluconeogenesis
stf00030  Pentose phosphate pathway
stf00051  Fructose and mannose metabolism
stf00052  Galactose metabolism
stf00680  Methane metabolism
stf01100  Metabolic pathways
stf01110  Biosynthesis of secondary metabolites
stf01120  Microbial metabolism in diverse environments
stf01130  Biosynthesis of antibiotics
stf01200  Carbon metabolism
stf01230  Biosynthesis of amino acids
stf03018  RNA degradation
Module
stf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssal_01270 (pfk)
   00030 Pentose phosphate pathway
    Ssal_01270 (pfk)
   00051 Fructose and mannose metabolism
    Ssal_01270 (pfk)
   00052 Galactose metabolism
    Ssal_01270 (pfk)
  Energy metabolism
   00680 Methane metabolism
    Ssal_01270 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ssal_01270 (pfk)
Enzymes [BR:stf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ssal_01270 (pfk)
Protein phosphatases and associated proteins [BR:stf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ssal_01270 (pfk)
Messenger RNA biogenesis [BR:stf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ssal_01270 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEJ53556
UniProt: F8HDK4
Position
complement(1248851..1249870)
Genome map
AA seq 339 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAARAVVLKAISEGIEVFGINRGYAGMVEGDIFQLDAKGVDNI
LSRGGTFLQSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATATEAIDKIQDTAFSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEYDINEVVRKVKEGYESGAKTHHVIVVAEGVMGAEEFAAKMKEAGD
TSDLRATNIGHVVRGGSPTARDRVLASWMGAHAVDLLKQGIGGVAVGIHNEELVESPILG
TAEEGALFSLTEDGKIIVNNPHRARLDFADLNRSLSNLS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggtggagatgcccctggtatgaacgctgccgct
cgtgcagttgttctcaaagcaatttctgaaggaattgaggtcttcggcattaaccgtgga
tacgctggtatggttgaaggagatatcttccaacttgatgccaaaggcgtagacaacatc
ctcagccgtggtggaactttccttcagtctgctcgctatcctgagtttgcccaacttgag
ggtcaacttaaaggtattgagcaacttaaaaaacatggaatcgaaggtgtagtagttatt
ggtggagatggttcttaccatggtgctatgcgtttgactgaacatggtttcccagctgtt
ggtcttccaggaactatcgataacgatatcgttggtacagactatacaattggttttgat
actgctgttgcaacagcaacagaagctatcgataagattcaagacactgctttcagtcac
ggacgtacttttgtcgttgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcttctggtgcagaccaaattatcgtacctgaagaagagtatgatattaacgaa
gttgtacgtaaagttaaagaaggttacgaatcaggtgctaaaactcaccacgtaatcgta
gttgctgaaggtgtcatgggtgctgaagaatttgcagctaaaatgaaagaagctggagat
acttcagatcttcgtgcaacaaacattggacacgtggttcgtggtggttcaccaactgcg
cgtgaccgtgttcttgcttcatggatgggtgcacatgcggttgacctccttaaacaaggt
attggtggtgtagctgttggtatccacaatgaagagcttgttgaaagcccaatccttggt
acagcagaagaaggcgctttgttcagtcttactgaagacggtaaaattatcgttaataat
ccacacagagctcgtcttgactttgcagatcttaaccgttcattgtctaacttgagctaa

DBGET integrated database retrieval system