KEGG   Streptococcus salivarius 57.I: Ssal_01280Help
Entry
Ssal_01280        CDS       T02088                                 

Gene name
gpm
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssal_01280 (gpm)
   01230 Biosynthesis of amino acids
    Ssal_01280 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssal_01280 (gpm)
  Energy metabolism
   00680 Methane metabolism
    Ssal_01280 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ssal_01280 (gpm)
Enzymes [BR:stf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Ssal_01280 (gpm)
Exosome [BR:stf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Ssal_01280 (gpm)
  Exosomal proteins of melanoma cells
   Ssal_01280 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1259881..1260573)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDDKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtctgaatggaacaaagctaaccttttc
acaggttgggctgacgtagatctttctgaaaaaggtactcaacaagctatcgacgctggt
aaattgatcaaagaagctggtatcgaatttgatcaagcatacacttcagtattgaaacgt
gcgatcaaaacaactaacttggctcttgaagcatctgaccaactttgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaacaaagcagaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgttttg
cctccagcaatggatcgtgatgatgagcactcagcacacactgatcgtcgttatgcttca
ctagacgactcagtaattccagatgctgaaaacttgaaagttactttggaacgtgccctt
ccattctgggaagataaaatcgctccagctcttaaagatggtaaaaacgtattcgtaggt
gcacacggtaactcaatccgtgcccttgttaaacacatcaaacaattgtcagatgacgaa
atcatggatgttgaaattccaaacttcccaccattggtattcgaatttgacgataaattg
aacgttgtttctgaatactaccttggaaaataa

DBGET integrated database retrieval system