KEGG   Streptococcus salivarius 57.I: Ssal_01349Help
Entry
Ssal_01349        CDS       T02088                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:stf00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:stf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1331973..1333316
Genome map
AA seq 447 aa AA seqDB search
MTMKTTMGILAGKASHFVLSKLGRGSTLPGKIALKFDKDILDTLAKNYEIVVVTGTNGKT
LTTALTVGILKEAFGEIVTNPSGANMITGITSTFLTAKKAKSGKKIAVLEIDEASLPKIT
EYITPSLFVFTNIFRDQMDRYGEIYTTYQMILDGAAKAPEATILANGDSPLFNSKEVVNP
VRFYGFDTEKHDPELAHYNTEGIVCPKCESILQYRLNTYANLGGYVCLNCDFHRPELDYK
LTELTKITNTTSEFVIDGQDYKINVGGLYNIYNALAAVSVAEFFGVAPEQIKAGFDKSRA
VFGRQETFKIGDKSCTLVLIKNPVGASQALDMIKLADYPFSLSVLLNANYADGIDTSWIW
DANFESILEMDIPEINAGGVRHSEIARRLRVTGYPEDKITQAEKLEDIMALIEKQDCDHA
YILATYTAMLEFRDILAQRHAVGKEMN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgactatgaaaactaccatgggaattctggcgggtaaagctagccatttcgtcctttca
aaattgggacgtggttcaaccctgcctggaaaaattgcccttaaatttgacaaagatatt
ttagacactttagccaagaactacgagattgtcgttgtcactggaaccaacggtaagact
ctgacaacagctttgacagtaggtattcttaaagaagcttttggtgagattgtgaccaat
cctagtggggccaacatgatcacagggatcacttctactttcctaacagctaaaaaagcc
aagtctggtaagaaaattgctgtcttggaaattgacgaggccagccttccaaaaatcact
gaatacatcactccaagtctttttgttttcacaaatattttccgtgaccaaatggaccgc
tatggtgaaatctataccacttatcagatgattttagatggtgctgctaaggcgcctgag
gctactattttggctaatggagacagtcctcttttcaattctaaagaggtagtcaatccc
gtgcgtttctacggttttgacactgaaaaacatgatccagagctggctcattataatact
gaaggtattgtctgccctaaatgtgagagtattcttcagtatcgccttaatacttacgct
aacttgggaggctatgtgtgccttaactgcgacttccaccgtccagaattagattataag
ctgacagagttgactaaaatcaccaacactacttctgaatttgtcattgatggacaagat
tacaagattaatgtcggtggtctttataacatctacaatgcccttgctgctgtttctgtc
gctgaattcttcggagtggctccagagcaaatcaaagctggttttgataagagtcgtgct
gtctttggacgccaagaaacctttaagattggtgacaaatcatgtaccctcgtactaatt
aagaatcccgtaggagccagccaagctcttgacatgattaaacttgccgattatccattt
agcttgtcagtcctacttaatgctaactatgctgatggcattgacaccagctggatttgg
gatgccaactttgaaagtattctcgaaatggatatccctgagattaatgctggtggtgta
cgccattctgaaattgcccgccgccttcgtgtgactggctatccagaggataagattacg
caagcagaaaaacttgaagatattatggccttgattgaaaaacaagattgcgatcatgcc
tatatcttggcgacctatactgccatgcttgaattccgtgatattcttgctcaacgtcat
gctgtcggaaaggagatgaactaa

DBGET integrated database retrieval system