KEGG   Streptococcus salivarius 57.I: Ssal_01383Help
Entry
Ssal_01383        CDS       T02088                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssal_01383 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssal_01383 (glk)
   00052 Galactose metabolism
    Ssal_01383 (glk)
   00500 Starch and sucrose metabolism
    Ssal_01383 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Ssal_01383 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ssal_01383 (glk)
   00524 Butirosin and neomycin biosynthesis
    Ssal_01383 (glk)
Enzymes [BR:stf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ssal_01383 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1374204..1375172)
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTVKFGILTSEGEVQEKWAIETNTLENGRHIVPNIVESLKHRLEMYGL
TAEDFIGIGMGSPGAVNRENKTVTGAFNLNWAETQEVGSVIEKELGIPFAIDNDANVAAL
GERWVGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVGGAGGEIGHIIVEPETGFECTCG
NKGCLETVASATGVVRLARHLAEGYEGDSSIKAAVDNGEQVTSKDIFVAAAEGDKFADSI
VDKVSEYLGLATANISNILNPDSVVIGGGVSAAGEFLRSRIEGYFTRYAFPQVRRTTKVK
LAELGNDAGIIGAASLALTIDN
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaactcttgggaattgaccttggtggaacaactgttaaatttggtattttg
acttcagaaggtgaagtccaagaaaaatgggcgattgaaacaaatacgcttgaaaatggt
cgtcacatcgtccctaacatcgtggagtctttgaaacaccgtttggaaatgtacggactt
actgcagaagatttcattggaattggtatgggttctccaggagctgttaatcgtgaaaat
aaaacggtcactggtgctttcaacttgaactgggcagaaactcaagaagttggatctgtc
atcgaaaaagaactcggtattccatttgcaattgataatgatgctaacgttgctgccctc
ggtgaacgttgggttggtgctggtgctaacaatcctgatgttgtctttgtgacattagga
acaggagttggtggcggcgttatcgctgatggtaacttgatccatggtgttggcggtgct
ggtggtgaaattggccacattatcgttgagcctgaaacaggatttgaatgtacttgcgga
aacaaaggatgcttggaaactgtagcttctgcaacaggtgtcgtacgtttggcacgtcat
ttagcagaaggatatgaaggtgactcttctattaaagctgctgtagataatggtgagcaa
gtaacaagtaaagatattttcgttgccgctgccgaaggcgacaaatttgctgatagcatc
gttgacaaagtctctgaatacctcggacttgcaacagcaaatatctcaaatattcttaac
ccagattcagttgtcatcggtggtggtgtttcagcagctggtgaattcttgcgtagccgt
atcgaaggatactttacacgttatgcattcccacaagttcgccgtacaacaaaagtgaaa
ttagcagaacttggaaatgatgctggtatcatcggagctgctagtcttgcacttacaatt
gataactaa

DBGET integrated database retrieval system