KEGG   Streptococcus salivarius 57.I: Ssal_01641Help
Entry
Ssal_01641        CDS       T02088                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ssal_01641 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ssal_01641 (pyrB)
Enzymes [BR:stf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Ssal_01641 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1610314..1611240)
Genome map
AA seq 308 aa AA seqDB search
MAIADGKVSLKHLVTMETLTNEEVLGLIRRGGDFKNGRADFQLDRQYFAANLFFENSTRT
HKSFEVAEKKLGLDVIEFDAGTSSVNKGETLYDTILTMSALGVDICVVRHSEVDYYKQLI
DSRTIQTSIVNGGDGSGQHPSQCLLDLMTIYEEFGTFENLKICIAGDITHSRVAKSNMQI
LKRLGAQLYFAGPAEWYSNEFDVYGQHVAIDDVIEDLDVLMLLRVQHERHGDDKGFSKED
YHALYGLTEERYAKLADQAIIMHPAPVNRDVEIADSLVEAPKARIVAQMQNGVFVRMAII
EAILNGKA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgcagatggaaaagtgtcactgaaacatttggtgacaatggaaaccctcacg
aatgaagaggtcttgggcctgattcgtcgaggtggagattttaaaaatggcagagctgat
ttccagctggatcgacagtatttcgctgccaatctcttttttgaaaattcaacacgaaca
cacaagtctttcgaagtggctgagaaaaaacttggcctggatgtgattgagttcgatgct
ggaactagctcggtgaacaagggtgagaccctctacgacacgatcttaaccatgtctgcc
ttgggcgttgacatctgtgtggtccgtcactcggaagtcgattactataagcagttgatt
gatagtagaactattcagacctctattgtcaatggtggtgatggttcagggcaacaccca
agtcagtgtttgcttgacttgatgaccatttacgaagagtttggaacctttgaaaatctt
aagatttgtattgcaggtgacattacgcattcgcgtgtcgctaagtcaaatatgcagatt
ctcaagcgtttgggagctcagctttattttgctggtccggcagagtggtactcgaatgag
tttgatgtttatggtcagcatgtggccattgacgacgtcattgaggacttggatgttctc
atgttgcttcgtgttcagcacgagcgtcatggggatgacaaaggattttcaaaagaagac
taccatgctctctatggtttgactgaagaacgttatgccaagttagctgatcaggcgatt
atcatgcaccctgctccggttaatcgtgatgtggagattgctgatagtctggttgaggca
cctaaggctcgtatcgttgctcagatgcaaaacggagtctttgtccgtatggcaattatt
gaagctattttaaatggcaaagcgtaa

DBGET integrated database retrieval system