KEGG   Streptococcus salivarius 57.I: Ssal_01888Help
Entry
Ssal_01888        CDS       T02088                                 

Gene name
dapE
Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ssal_01888 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ssal_01888 (dapE)
Enzymes [BR:stf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ssal_01888 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1854673..1856067)
Genome map
AA seq 464 aa AA seqDB search
MYEGDDLMAFSSEEEQLRKFRNDEIAQHYFEVLRTLISKKSIFAQNIGLYDVAAYLGEIF
SGVGAEVTIDETYTAPFVLAKFKSPNPDAKTIIFYQHYDTVPADNDQPWTDEPFRLTVRK
GYMYGRGVDDDKGHITARLTALRKYIREVGDLPVNITFMMEGAEESASTDLEKYLEKYRD
DLLPADLLVWEQGNRNSKGQLEITGGNKGIITFDLSVESADVDIHSKFGAVIESASWYLL
NAISSMRDDQGRILIDGIYEKIVQPNEREMDLIETYAIENADSLRKIYGLKLPILESDRR
AFLKTYYFEPALSIEGISTGYQGQGVKTILPAQAKAKMEMRLVPGLTPEYVLECIKAHLK
KEGFDRIKVTFTLGEESYRSDMSDPAIVNVIELAKGFYEEGVAVLPTAAGTGPMHMIHQA
LGVPMAAFGIGNANSRDHGGDENVSLADYYTHIELIKELIASYE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgaaggagacgatttgatggcattttcaagtgaagaagagcagttacgaaaattt
cgtaacgatgaaattgctcagcactattttgaagtcttgcggactttgatttctaaaaaa
tctatttttgctcaaaatattggtctctatgatgtggctgcttaccttggtgagattttc
tctggtgttggtgcagaggtgacaattgacgagacctatacggcaccttttgtcttggca
aaattcaagagtccaaatccagatgcgaaaacaattattttctatcaacactatgatacg
gttcctgcggataatgatcagccatggacagatgaacctttccgtctgactgttcgtaag
ggctacatgtatggtcgtggtgttgatgatgataaggggcatattacagctcgtttgaca
gcccttcggaaatatattcgagaagttggcgaccttcctgtaaatattacgtttatgatg
gaaggggctgaagaatctgcatcaactgaccttgaaaaatatttggaaaaataccgagat
gaccttcttccagcagacctattggtttgggaacaaggaaatcgaaatagtaaaggtcaa
ttggaaatcacagggggcaacaaggggattattacctttgacttgtctgtcgagagtgct
gatgttgatatccactctaaatttggtgccgtgattgaatcggcctcatggtacttgctc
aatgctatctcaagcatgagagatgatcagggacgtatccttatcgacggcatctatgaa
aagattgtccaaccaaacgaacgagagatggatcttattgaaacttatgccattgaaaat
gcagatagtcttcgtaagatttacggcttaaaactacccattttagaaagtgaccgccga
gctttcttaaaaacttactattttgaacctgccctttccattgaaggtatttcaacaggt
tatcaggggcaaggggttaagactatcttaccagctcaagctaaagctaagatggagatg
cgtttggtccctggcttgacgcctgagtacgttttggagtgtatcaaggcacacctcaaa
aaagaaggatttgaccgtatcaaggtgaccttcactcttggtgaagaaagttatcgtagt
gatatgtctgatccagctattgtcaatgttattgagttagcaaaaggtttttatgaagaa
ggcgttgctgtgcttccaacggcagcaggtacagggcctatgcatatgattcatcaggct
ttgggtgttcctatggcagcctttggtatagggaatgccaacagtcgtgaccatggtggg
gatgaaaatgtcagcttagcagattactacacccacattgaactaattaaggagttaatt
gcaagttatgagtaa

DBGET integrated database retrieval system