KEGG   Streptococcus salivarius 57.I: Ssal_01921Help
Entry
Ssal_01921        CDS       T02088                                 

Definition
nucleoside-triphosphatase
Orthology
K02428  
XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
stf  Streptococcus salivarius 57.I
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:stf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ssal_01921
Enzymes [BR:stf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Ssal_01921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1881155..1882129)
Genome map
AA seq 324 aa AA seqDB search
MTKSIFEYKDEQDWYLASFGNYNHLTCFGGDEAYEQFVDFFQALTNVLAVSGFQLHIAKH
SSDLRLVSFILDCLKEETGRDLAVTQHQGALVVSEGDKLVYVHVPREGVALSDFFGSDNK
SDFGDVLLIATRNEGKTKEFRKLFGKLGIKVENLNDYPDLPEVAETGMTFEENARLKAET
ISELTGKMVLSDDSGLQVDVLGGLPGVWSARFAGPDATDDENNAKLLHELAMVLDDSKRT
ANFHTTLVVAAPGRDSLVVDADWKGYIGREPKGDNGFGYDPLFLVGNTGKTAAELSAEEK
NEQSHRGQAVKKLMEVFPAWQNKQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgactaaatcaatttttgaatataaagacgaacaagactggtatttggctagttttgga
aactacaatcacttgacttgttttggtggtgatgaggcctatgagcaatttgttgacttt
ttccaagctttgactaacgttttggctgttagtggctttcagttacatattgcgaaacat
tcttcagaccttcgcttggtatcctttattttggattgcttgaaagaggaaactggtcgt
gacctagctgttacgcaacatcaaggggctttggtagttagtgaaggagataagcttgtc
tatgtacatgtgcctagagaaggtgtcgccttgagcgatttctttggttctgataacaaa
tcagactttggtgatgtcctattgattgcgacacgcaatgaaggaaaaaccaaggaattt
cgtaaactatttggaaaactaggtattaaggtagagaatcttaatgattatccagacctt
cctgaagttgctgaaacgggtatgacctttgaagaaaatgcacgcttgaaggcggaaacc
atttctgaattaactggtaaaatggtcctttcagatgactctggtttgcaggtagatgtt
cttggaggtttaccaggagtttggtctgctcgctttgctggtcctgatgctacggatgat
gaaaataatgctaaattattacacgagctggctatggtgcttgatgatagcaaacgtact
gcgaacttccatacaaccctagttgttgcagcccctggacgtgatagtttggttgttgat
gccgactggaagggttatattggccgagaaccgaaaggtgacaatggttttggttatgat
ccactctttttagttggtaatacgggtaaaacggcagcagagctttctgcagaagagaaa
aatgaacaatctcaccgtggacaagctgttaagaaacttatggaggtcttcccagcatgg
cagaacaaacaataa

DBGET integrated database retrieval system