KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_0061Help
Entry
MGAS15252_0061    CDS       T01794                                 

Gene name
adhP
Definition
alcohol dehydrogenase protein AdhP
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MGAS15252_0061 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS15252_0061 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    MGAS15252_0061 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MGAS15252_0061 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MGAS15252_0061 (adhP)
   00626 Naphthalene degradation
    MGAS15252_0061 (adhP)
Enzymes [BR:stg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MGAS15252_0061 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
55212..56228
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQASTGVEVVEHDLPNIGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLKVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAVVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIVIFGAGGLGNLAVQ
YAKKVFNAHVVAVDINNDKLELAKEVGADIVVNGKEIEDVPGYIQEKTGGAHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIKVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVDTAPEVFDEMERGLIQGRKVLDFIS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtagttgttaatcaagctagtacaggtgtcgaagttgttgaacatgatctt
ccaaatattggtcatggtgaagcgcttgttaaagtagaatactgtggcgtttgtcatact
gatttacacgttgcacatggcgattttggtcaggtaccaggacgtattttggggcacgaa
ggtattggtatagtagaagaaattggagaaggcgtaacatccttaaaggttggtgatcgt
gtctctattgcatggttctttgaaggatgtggtcattgcgaatactgtactacaggacgt
gagacactttgtcgtagtgttaaaaatgctggatacagtgttgatggaggaatgagtgaa
tatgcagtagtaacagctgattatgcagttaaagttccagaaggtttagacccggctcaa
gcttcttccattacttgtgctggtgtaacaacttataaagctattaaagaggcaggtgct
gctccaggccaatggattgttatctttggggcaggtggccttggaaatctggctgttcaa
tacgctaaaaaagtctttaatgcacatgttgtcgcagtggacattaataatgataaactt
gagttagctaaagaagttggcgcagatattgtagttaacggcaaagaaattgaagatgtt
ccaggctatattcaagaaaaaaccggtggagcacatggtgttgtggtaacggctgtttct
aaagttgcttttaaccaagcaattgatagtgtccgtgccggtgggacagttgtagccgta
ggtcttccatcagaatacatggaactgtctatcgtaaaaactgttttagatggtatcaaa
gtggtcggatcacttgtagggacacgtaaagacttggaagaagcctttgcctttggtgca
gaaggtctggttgttccggttgtcgaaaaagttccagttgacactgctccagaagtcttt
gatgaaatggaacgtggtttaatccaagggcgcaaggtcttagatttcatcagctaa

DBGET integrated database retrieval system