KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_0230Help
Entry
MGAS15252_0230    CDS       T01794                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase/Glutamyl-tRNA(Gln) synthetase protein GltX
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:stg00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206889..208334
Genome map
AA seq 481 aa AA seqDB search
MSKPIRVRYAPSPTGLLHIGNARTALFNYLYARRHGGTFIIRIEDTDRKRHVEDGERSQL
ENLKWLGMDWDESPETHENYRQSERLALYQQYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEFIGMSADEKAKYIAEREAAGIVPTVRLAVNESGIYKWTDMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMPEAVFNFIALLGWNPGGEEEIFSR
EQLIALFDENRLSKSPAAFDQKKMDWMSNEYLKHADFETVYALCKPFLEEAGRLTEKAEK
LVELYKPQLKSADEIIPLTDLFFSDFPELTEAEKEVMAGETVSTVLQAFKAKLEAMSDED
FKPENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPNTIYLLGRDKSIEHIKNM
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaccaattcgtgtgcgttatgcaccaagtccaacagggcttttacatatcggg
aatgcccgcacagccctatttaattacctttatgcccgtcgtcacggaggtacttttatc
attcgtattgaagatactgaccgtaaacgtcatgttgaagatggtgaacgttctcaactt
gaaaacctaaaatggttaggaatggattgggatgaaagcccagaaacgcatgaaaattac
cgccagtctgaacgtctagcactttatcaacaatatattgatcaattgttagctgaagga
aaagcctataagtcttacgtgactgaggaagaattggcagcagagcgtgaacgccaagaa
gcagctggcgaaacgcctcgctatatcaatgaatttattggtatgtcagctgacgaaaaa
gctaagtacattgcagagcgtgaagcagcaggtatcgttccaacagtccgtcttgctgtt
aatgagtccggtatttacaaatggactgacatggttaaaggcgatatcgagtttgaaggt
ggtaatatcggtggtgactgggttattcaaaagaaagatggctacccaacttataacttt
gccgttgttgttgatgatcatgatatgcaaatttctcacgttatccgtggcgatgaccat
attgccaatacgccaaaacaattgatggtctatgaagctcttggctgggaagcgccagag
tttggtcatatgacgcttatcatcaattctgaaacgggtaaaaaattatcaaaacgcgac
accaataccctccaattcattgaagattaccgcaaaaaaggttatatgcctgaagctgtc
tttaacttcatcgcccttcttggctggaatcctggcggagaagaggaaatcttctctcgt
gagcaactgattgccctttttgatgaaaatcgccttagcaagtcgccagctgcctttgac
cagaagaaaatggattggatgagcaatgagtatcttaaacatgcggattttgaaacagtt
tatgccctctgcaaaccattccttgaagaggcaggccgtttgacagaaaaagctgagaag
ctagtagaattatacaaacctcaattaaaatctgcagatgagattattccattgactgac
cttttcttttctgatttccctgaattaacagaggccgaaaaagaagtgatggcaggtgaa
acagtttcgacagtcttgcaagctttcaaggctaagttggaagctatgtcagatgaagac
ttcaaaccagaaaatattttcccacaaattaaggctgttcaaaaagaaacaggaatcaaa
gggaaaaacctctttatgcctattcgtattgcagtatctggtgaaatgcatggcccagaa
ttaccaaatacgatttatttattgggacgtgataaatccattgagcacatcaaaaacatg
ctataa

DBGET integrated database retrieval system