KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_0461Help
Entry
MGAS15252_0461    CDS       T01794                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
stg00071  Fatty acid degradation
stg00072  Synthesis and degradation of ketone bodies
stg00280  Valine, leucine and isoleucine degradation
stg00310  Lysine degradation
stg00362  Benzoate degradation
stg00380  Tryptophan metabolism
stg00620  Pyruvate metabolism
stg00630  Glyoxylate and dicarboxylate metabolism
stg00640  Propanoate metabolism
stg00650  Butanoate metabolism
stg00900  Terpenoid backbone biosynthesis
stg01100  Metabolic pathways
stg01110  Biosynthesis of secondary metabolites
stg01120  Microbial metabolism in diverse environments
stg01130  Biosynthesis of antibiotics
stg01200  Carbon metabolism
stg01212  Fatty acid metabolism
stg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS15252_0461
   00630 Glyoxylate and dicarboxylate metabolism
    MGAS15252_0461
   00640 Propanoate metabolism
    MGAS15252_0461
   00650 Butanoate metabolism
    MGAS15252_0461
  Lipid metabolism
   00071 Fatty acid degradation
    MGAS15252_0461
   00072 Synthesis and degradation of ketone bodies
    MGAS15252_0461
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGAS15252_0461
   00310 Lysine degradation
    MGAS15252_0461
   00380 Tryptophan metabolism
    MGAS15252_0461
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS15252_0461
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGAS15252_0461
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MGAS15252_0461
Enzymes [BR:stg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGAS15252_0461
Exosome [BR:stg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAS15252_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFC65812
Position
427220..428368
Genome map
AA seq 382 aa AA seqDB search
MTDVYIATGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPIDQVICGNTVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEYLNHWTLRSHQKASYCQE
QALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEGHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPYGASTAIIILHLMRALEIKNGRYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctacaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagaacaaccagaaatccttggagcaaagctcatcaatgctttacaaaataag
tatccagttcccattgaccaagtgatttgtggcaataccgtcggaacgggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggagcctacaaggtagctcagttttctccagatagt
atcagcccttttgcgatgattgaaggggcagaacgagtggcaagagagcatggctttaca
aaggagtatttgaatcactggacattgagaagtcatcaaaaggctagttattgccaggag
caagccctgttagctgatcttattctagacctgccaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaaggtcacgtg
attagtgcagccaatgcctgcctaacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgattgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggaaaaacatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtctatttgaaacc
cattatccagatttattggaccgctataatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcaacagccattataatattgcacttaatgagggctttagagattaaa
aatggacgctatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system