KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_0714Help
Entry
MGAS15252_0714    CDS       T01794                                 

Gene name
folA
Definition
fihydrofolate reductase protein FolA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGAS15252_0714 (folA)
   00670 One carbon pool by folate
    MGAS15252_0714 (folA)
Enzymes [BR:stg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MGAS15252_0714 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
696129..696626
Genome map
AA seq 165 aa AA seqDB search
MTKEIIAIWAEDEAGLIGVAGKLPWYLPKELEHFKKTTLHQAILMGRVTFEGMNCKRLPQ
RQTLVMTRNRDYQVDEVLTMTSIEKVLEWYHAQDKTLYIIGGNKVLEAFNGYFDRIIKTV
IHHRFKGDTYRPNLDFSHFTQESQTFYARDAKNPYDFTVTALKHK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggaaattattgctatttgggcagaggatgaagcagggcttattggtgttgcg
ggtaagttaccatggtatttaccaaaagagttagaacattttaaaaagacaacgctacat
caagcaatcttaatgggccgtgtgacttttgaaggaatgaattgcaaaagacttcctcaa
cgtcaaacccttgtcatgacaagaaatagagattatcaagtagatgaggtgttgacaatg
actagtattgaaaaagtcttggagtggtaccatgcgcaggataaaacactttatatcatt
ggtgggaataaggttttagaagcgtttaatggttattttgatcgtatcataaaaacagtt
atccatcatcgttttaaaggagatacctaccgacccaatctagattttagtcatttcacg
caagaaagccaaacgttctatgctcgagacgctaaaaatccttatgattttaccgttact
gctttaaaacacaaatag

DBGET integrated database retrieval system