KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_0824Help
Entry
MGAS15252_0824    CDS       T01794                                 

Gene name
folP
Definition
dihydropteroate synthase protein FolP
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGAS15252_0824 (folP)
Enzymes [BR:stg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MGAS15252_0824 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
809856..810656
Genome map
AA seq 266 aa AA seqDB search
MKIGRFVIEGNAAIMGILNVTPDSFSDGGSYTTVQKALDHVEQMIADGAKIIDVGGESTR
PGCQFVSAADEIDRVVPVIKAIKENYDILISIDTYKTETARAALEAGADILNDVWAGLYD
GQMFALAAEYDAPIILMHNQDEEVYQEVTQDVCDFLGNRAQAALDAGVPKNNIWIDPGFG
FAKSVQQNMELLKGLDRVCQLGYPVLFGISRKRVVDALLGGNTKAKERDGATAALSAYAL
GKGCQIVRVHDVKANQDIVAVLSQLM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaaggtttgtgattgagggcaatgcggctatcatggggattttaaatgtg
actccagattctttttcagatggggggtcttacactactgtgcaaaaagcattagatcac
gttgagcaaatgattgctgatggtgctaaaatcatcgacgttggtggagaatcaacacgt
ccaggttgccaatttgtaagcgctgccgatgaaattgaccgggtggttcctgtgatcaag
gctatcaaagaaaactatgatattctaatcagcattgatacctataaaaccgaaacagct
agagcagctttagaggcgggtgccgatattctcaatgatgtttgggcaggtttgtacgac
ggacaaatgtttgccttagcagccgagtacgatgcgcctatcatcttgatgcataaccaa
gacgaagaagtttatcaagaggtaacacaagacgtttgtgattttctaggcaatagagca
caagcagctcttgatgctggcgtgccaaaaaacaatatttggattgatccaggatttgga
tttgccaaatctgttcaacagaatatggagttattaaaaggattggaccgcgtctgtcag
ttgggctatcctgtcttgtttggtatttcgagaaagcgtgtcgtagatgccttgttaggc
ggcaacaccaaagctaaagagcgagacggagcgacagcagccttgtctgcttatgccctt
ggaaaaggctgtcagattgtacgcgtacacgatgtcaaggctaatcaagacattgtggct
gtgttgagccagttgatgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system