KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_1240Help
Entry
MGAS15252_1240    CDS       T01794                                 

Gene name
atoB.2
Definition
(GenBank) 3-ketoacyl-CoA thiolase/acetyl-CoA acetyltransferase protein AtoB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
stg00071  Fatty acid degradation
stg00072  Synthesis and degradation of ketone bodies
stg00280  Valine, leucine and isoleucine degradation
stg00310  Lysine degradation
stg00362  Benzoate degradation
stg00380  Tryptophan metabolism
stg00620  Pyruvate metabolism
stg00630  Glyoxylate and dicarboxylate metabolism
stg00640  Propanoate metabolism
stg00650  Butanoate metabolism
stg00900  Terpenoid backbone biosynthesis
stg01100  Metabolic pathways
stg01110  Biosynthesis of secondary metabolites
stg01120  Microbial metabolism in diverse environments
stg01130  Biosynthesis of antibiotics
stg01200  Carbon metabolism
stg01212  Fatty acid metabolism
stg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS15252_1240 (atoB.2)
   00630 Glyoxylate and dicarboxylate metabolism
    MGAS15252_1240 (atoB.2)
   00640 Propanoate metabolism
    MGAS15252_1240 (atoB.2)
   00650 Butanoate metabolism
    MGAS15252_1240 (atoB.2)
  Lipid metabolism
   00071 Fatty acid degradation
    MGAS15252_1240 (atoB.2)
   00072 Synthesis and degradation of ketone bodies
    MGAS15252_1240 (atoB.2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGAS15252_1240 (atoB.2)
   00310 Lysine degradation
    MGAS15252_1240 (atoB.2)
   00380 Tryptophan metabolism
    MGAS15252_1240 (atoB.2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS15252_1240 (atoB.2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGAS15252_1240 (atoB.2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MGAS15252_1240 (atoB.2)
Enzymes [BR:stg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGAS15252_1240 (atoB.2)
Exosome [BR:stg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAS15252_1240 (atoB.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AFC66565
Position
1234263..1235450
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLAAQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAAKALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagatatggtttgcggttctggacttaaagcaatccaattagctgcgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtcgaaaacatgtcacaa
gcagcttatgtctcaactcagcaccgctttggtcaacgtcttggtaatagtcaattgatt
gatactcttgttcatgatggcttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctaaagcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagaccctttaattgttacaacagatgaataccca
aaagttgatacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccgttactgctgggaatgcctcaggaataaacgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgatttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gttaatggaggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system