KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_1278Help
Entry
MGAS15252_1278    CDS       T01794                                 

Gene name
glpK
Definition
glycerol kinase protein GlpK
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MGAS15252_1278 (glpK)
Enzymes [BR:stg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MGAS15252_1278 (glpK)
Exosome [BR:stg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAS15252_1278 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1275680..1277206)
Genome map
AA seq 508 aa AA seqDB search
MSQEKYIMAIDQGTTSSRAIIFNQKGEKVSSSQKEFPQIFPHAGWVEHNANQIWNSVQSV
IAGAFIESSIKPSQIEAIGITNQRETTVVWDKKTGVPIYNAIVWQSRQTAPIAEQLKQDG
HTKMIHEKTGLVIDAYFSATKIRWILDHVPGAQERAEKGELLFGTIDTWLVWKLTDGAVH
VTDYSNAARTMLYNIKDLTWDDEILELLNIPKDMLPEVKSNSEIYGKTAAFHFYGGEVPI
SGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGDEMQLSSNNLLTTIGYGINGKVH
YALEGSIFIAGSAIQWLRDGLKMIETSPESEQFALASTSDDEVYVVPAFTGLGAPYWDSN
ARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQQLRVDGGAAMNNMLM
QFQADILGIDIARAKNLETTALGAAFLAGLAVGYWEDMDALKELNATGQLFKASMNESRK
EKLYKGWKRAVKATQVFTQEEDADDDAK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagaaaagtatatcatggctattgatcagggaacaacaagttcacgagcgatt
attttcaatcaaaaaggggaaaaggttagcagtagccaaaaagaattccctcagattttc
ccacacgctggttgggtagagcacaatgctaatcagatttggaattcggttcagtctgtt
attgcgggtgcttttattgagtccagcatcaaaccaagccaaattgaagcaatcggaatt
accaaccaacgtgagaccacagtggtttgggacaaaaaaacgggtgtacctatttataat
gctattgtgtggcaatcacgacagacggcaccaattgctgagcaactcaaacaagatggc
catacaaaaatgatccatgaaaaaacaggccttgttattgatgcctacttttctgcaacc
aagatccgttggattttagatcatgttcctggtgctcaagaacgagctgaaaaaggcgag
ttactttttggaaccattgatacttggctggtttggaaactaacagatggtgctgttcat
gtgacggattattccaatgcggctcgtaccatgctctataatattaaagacttaacatgg
gatgatgagattttagagcttttaaatattccaaaagatatgcttccagaggttaaatcc
aattctgaaatttatggcaaaacagctgcctttcatttttatgggggcgaagtgcctatt
tcaggtatggcgggtgaccaacaggcagctttgtttggccaactagcttttgagcctggt
atggtgaaaaacacttatggcacaggttctttcattatcatgaatactggtgatgagatg
cagttatcgagtaataatcttttgaccaccattggttacgggattaatgggaaggttcac
tatgccttggaaggttccatctttattgcaggctctgccattcaatggttgcgagatggt
cttaaaatgattgagacttcaccagaatctgaacagttcgctctagcatcaactagtgac
gatgaagtttatgttgtgcctgcttttaccggtttaggagctccttactgggattctaat
gcgcgtggatctgtctttggcttgacacgtggtaccagcaaagaagactttgtcaaagca
accttacaatctatcgcctatcaagtgcgagatgttattgataccatgcaggtggattca
ggtattgacattcaacagctccgtgtggatggcggtgcagccatgaataatatgctcatg
caatttcaggctgatattttaggaattgatattgcccgtgctaaaaatttagaaacaaca
gctctaggagcagctttcttagcagggcttgctgtggggtactgggaagatatggatgct
ttgaaagaattaaatgccacaggccagctctttaaggctagcatgaatgaatcgcgcaaa
gaaaaattatacaagggttggaagcgcgctgttaaagcaactcaagttttcacccaagaa
gaagatgcagatgacgatgcaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system