KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_1331Help
Entry
MGAS15252_1331    CDS       T01794                                 

Gene name
accD
Definition
(GenBank) acetyl-coenzyme A carboxyl transferase beta subunit AccD
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
stg00061  Fatty acid biosynthesis
stg00620  Pyruvate metabolism
stg00640  Propanoate metabolism
stg01100  Metabolic pathways
stg01110  Biosynthesis of secondary metabolites
stg01120  Microbial metabolism in diverse environments
stg01130  Biosynthesis of antibiotics
stg01200  Carbon metabolism
stg01212  Fatty acid metabolism
Module
stg_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:stg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS15252_1331 (accD)
   00640 Propanoate metabolism
    MGAS15252_1331 (accD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    MGAS15252_1331 (accD)
Enzymes [BR:stg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     MGAS15252_1331 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MGAS15252_1331 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans Cys_rich_CPCC IBR RNA_POL_M_15KD
Motif
Other DBs
NCBI-ProteinID: AFC66655
Position
complement(1324435..1325301)
Genome map
AA seq 288 aa AA seqDB search
MALFRKKDKYIRITPNNSLKGSVSHNVPEVPDELFAKCPACKHMIYKKDLGLAKICPTCS
YNFRISAQERLTLTVDEGSFQELFISIETKDPLRFPGYQEKLQKAKETTGLHEAVLTGKA
MVKGQQIALAIMDSHFIMASMGTVVGEKITRLFELAIEENLPVVIFTASGGARMQEGIMS
LMQMAKVSAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFAGRRVI
ETTVRENLPDDFQKAEFLQDHGFVDAIVKRTELRDKIAHLVAFHGGGQ
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggctttatttcgtaaaaaagataaatacatccgtattactcctaataattccctcaaa
ggatctgtcagccataatgtcccagaagttccagatgaactctttgcgaaatgcccagct
tgtaagcacatgatttataagaaagatttgggattggcaaagatttgcccaacctgttct
tacaattttaggatttctgcccaagagcgactgaccttaacagttgatgaaggctctttc
caggaattatttataagtattgaaaccaaggatccgttacgttttccaggttatcaggaa
aaattacaaaaagccaaggaaacaactggtctgcatgaagctgttttgacagggaaagct
atggttaaaggacaacaaattgctcttgctattatggattctcactttattatggctagt
atgggaactgttgttggggaaaaaattacccgattgtttgaattggctatcgaagaaaac
ctgccggtggtgatttttacggcttcaggaggcgcccgtatgcaagaggggatcatgagc
ctcatgcaaatggccaaggtctctgcagctgtgaaaagacattctaatgcaggcctcttt
tacctcactattttgacagatccaactactggtggggtaacagctagttttgccatggaa
ggggatattattttggcagaacctcaatccttggttggctttgcaggtcgtcgtgtcatt
gagaccacagttcgtgaaaacttgccagatgatttccaaaaagcagaatttttacaagac
catggttttgtggatgctattgtgaaacgaacagagttgcgagacaagattgcccactta
gtagcatttcatggaggtggccaatga

DBGET integrated database retrieval system