KEGG   Streptococcus pyogenes MGAS15252 (serotype M59): MGAS15252_1331Help
Entry
MGAS15252_1331    CDS       T01794                                 

Gene name
accD
Definition
acetyl-coenzyme A carboxyl transferase beta subunit AccD
Orthology
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
Organism
stg  Streptococcus pyogenes MGAS15252 (serotype M59)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Carbon metabolism [PATH:stg01200]
Metabolism; Overview; Fatty acid metabolism [PATH:stg01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:stg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:stg00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:stg00061]
Metabolism; Metabolism of terpenoids and polyketides; Tetracycline biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1324435..1325301)
Genome map
AA seq 288 aa AA seqDB search
MALFRKKDKYIRITPNNSLKGSVSHNVPEVPDELFAKCPACKHMIYKKDLGLAKICPTCS
YNFRISAQERLTLTVDEGSFQELFISIETKDPLRFPGYQEKLQKAKETTGLHEAVLTGKA
MVKGQQIALAIMDSHFIMASMGTVVGEKITRLFELAIEENLPVVIFTASGGARMQEGIMS
LMQMAKVSAAVKRHSNAGLFYLTILTDPTTGGVTASFAMEGDIILAEPQSLVGFAGRRVI
ETTVRENLPDDFQKAEFLQDHGFVDAIVKRTELRDKIAHLVAFHGGGQ
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggctttatttcgtaaaaaagataaatacatccgtattactcctaataattccctcaaa
ggatctgtcagccataatgtcccagaagttccagatgaactctttgcgaaatgcccagct
tgtaagcacatgatttataagaaagatttgggattggcaaagatttgcccaacctgttct
tacaattttaggatttctgcccaagagcgactgaccttaacagttgatgaaggctctttc
caggaattatttataagtattgaaaccaaggatccgttacgttttccaggttatcaggaa
aaattacaaaaagccaaggaaacaactggtctgcatgaagctgttttgacagggaaagct
atggttaaaggacaacaaattgctcttgctattatggattctcactttattatggctagt
atgggaactgttgttggggaaaaaattacccgattgtttgaattggctatcgaagaaaac
ctgccggtggtgatttttacggcttcaggaggcgcccgtatgcaagaggggatcatgagc
ctcatgcaaatggccaaggtctctgcagctgtgaaaagacattctaatgcaggcctcttt
tacctcactattttgacagatccaactactggtggggtaacagctagttttgccatggaa
ggggatattattttggcagaacctcaatccttggttggctttgcaggtcgtcgtgtcatt
gagaccacagttcgtgaaaacttgccagatgatttccaaaaagcagaatttttacaagac
catggttttgtggatgctattgtgaaacgaacagagttgcgagacaagattgcccactta
gtagcatttcatggaggtggccaatga

DBGET integrated database retrieval system