KEGG   Symbiobacterium thermophilum: STH1021Help
Entry
STH1021           CDS       T00196                                 

Definition
hypothetical protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sth  Symbiobacterium thermophilum
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sth01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1135378..1136106
Genome map
AA seq 242 aa AA seqDB search
MRRVLVVALAVAAIAAVALWRAGRPSPKQQSALQAPAVELARAALPEVLTPDPRVDRSGW
PVIVAFGDSLTAGLGVDPDRNYPSQLQALLDERGYRYRVVNAGVSGELTAGGLSRVDQVL
EHRPAVVILELGANDGMQARPVAEVRENLAGIIARLQEEGVAVLLAGMRAPPNHGPEYEA
AFAQVYPDLAAEFGVPLIPFFLEGVAGSPYLNQRDGIHPTAQGYAIVVRTVLSALEPLLQ
PP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgttctcgtcgtcgcactggccgtggccgcgatcgccgcggtcgcgctgtgg
cgggccggccggccctcgccgaagcagcagtcggcgctgcaggcgccggcggtcgagctg
gcgcgcgcggccctgccggaggtgctcacgccggacccgcgggtcgaccgcagcggctgg
cccgtcatcgtcgccttcggcgacagcctcaccgcggggctgggagtggacccggaccgg
aactaccccagccagctgcaggcgctgctggacgagcggggctaccggtaccgggtggtc
aacgccggcgtctccggggagctgacggccggcggcctcagccgggtcgaccaggtgctg
gagcaccggccggccgtggtcatcctggagctgggcgccaacgacggcatgcaggcgcgt
ccggtggcggaggtgcgggagaatctggccggcatcatcgcacggctgcaggaggagggg
gtcgccgtgctgctggcgggcatgcgggcgccgcccaaccacggccccgagtatgaggcg
gccttcgcgcaggtctacccggacctggcggccgagttcggcgtccccctcatccccttc
ttcctggagggggtggcggggtcgccctacctgaaccagcgcgacggcatccatcccacc
gcgcaggggtacgccatcgtggtcagaacggttctgtcggcgctggagccgctgctgcag
ccgccctga

DBGET integrated database retrieval system