KEGG   Symbiobacterium thermophilum: STH1079Help
Entry
STH1079           CDS       T00196                                 

Definition
(GenBank) endo-1,4-beta-glucanase
Organism
sth  Symbiobacterium thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1193010..1194065
Genome map
AA seq 351 aa AA seqDB search
MDITQHLAELTRLSSITGRERAVAEYLLQAWAPLVDEAYLDRLGSYVGVKRGEGPEPRPR
VLAAAHIDSIGGVVTAIEPGGFIRFNPVGGVDRRLLMAQEMEVHGRRVIPGVVGSKPPHV
TSPEERKRLVPVEELYIDTGLPEDEVRALVQVGDPVLFRYQFRILQNGRISSRYLDNRAS
QAALAVALQELQGLRHSADFYAVGTVGEEFGAYAGATAAAFALQPDIAIAVDVTFARHPG
AEKDTFPLGGGPAIGVGPSCTPQVVKLMRKVAEEVGIDYQVEVMAGPSGTDAWGMQEVRG
GVATAILSIPLRYMHTPVELVDLADIRQAGRLLAHVVARIDQAFVEELRCF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ttggacatcacccaacacctggcagaactgacccgactcagcagcatcaccgggcgtgag
cgggcggtggcggagtatctcctgcaggcctgggctccgctggtggacgaggcgtacctg
gaccgcctcggcagctacgtcggcgtgaagcggggcgaggggcccgagccccgcccgcgc
gtgctggccgcggcccacatcgactccatcggcggcgtggtgaccgcgatcgagcccggc
ggcttcattcggttcaaccccgtgggcggagtggaccgccggcttctgatggcccaggag
atggaggttcacggccgccgcgtgattcccggcgtggtgggctccaagccgccccacgtg
accagccccgaggagcgcaagcggctggtgccggtggaggagctctatatcgacaccggc
ctgccggaggacgaggtgcgggcgctggttcaggtcggcgacccggtgctgttccgctac
cagttccgaatcctgcagaacgggcgcatctccagccggtacctggacaaccgggcgagc
caggccgccctggccgtggcgctgcaggagctgcaggggctgcgccacagcgccgacttc
tacgcggtgggcacggtgggcgaggagttcggcgcttacgcgggtgcgacggcagccgcg
ttcgccctgcagccggacattgccatcgccgtcgacgtgaccttcgcccgccaccccgga
gcggaaaaggacaccttccccctgggcggggggcccgccatcggggtgggacccagctgc
acgccccaggtggtgaagctcatgcgcaaggttgcggaggaggtcggcatcgactaccag
gtggaggtgatggccggcccctcgggcaccgacgcctggggcatgcaggaggtgcggggc
ggggtggcgacggccatcctctcgatcccgctccggtacatgcacacgccggtggagctg
gtggacctggccgacatccggcaggccggccggctgctggcgcacgtcgtggcgcgaatc
gatcaggcctttgtggaggagttgcgatgcttctag

DBGET integrated database retrieval system