KEGG   Symbiobacterium thermophilum: STH1080Help
Entry
STH1080           CDS       T00196                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sth  Symbiobacterium thermophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sth00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1194056..1195084
Genome map
AA seq 342 aa AA seqDB search
MLLERLSNACGVSGDEGEVRALLKEVLAPRVDEMWSDPMGNLIVRKGSGPVRVMLDAHMD
EVGFLVGEITDEGYLSLRKVGGLDDRVLPGRQVWVTHRRIPGVIGAKAWHLCSPEERGKV
IPFDEMYVDLGCRSRAEVEALGIELGDPVYFATEFELLGDRVAKGKALDDRVGCTVLARV
LLEYDFPGITLLGAFTTQEEVGLRGAKAAAFHLNPDVALALEGTGSANVAGVDPFDTITN
MGEGPVISLMDAAGIPHKRVQEELIRLARKHGIRHQFRRLTSGGTDAGAIARSRQGVPAC
TISVPCRYIHTNAALCHLDDVDGAVQLVRRFLESVEKGEFRP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcttctagaacggctgtccaacgcctgcggcgtgtcaggcgacgagggcgaggtgcgc
gccctcctgaaggaggtcctggcgccgcgggtcgatgagatgtggtccgacccgatgggc
aacctgatcgtccgcaagggatcggggcccgtgcgggtgatgctggacgcccacatggac
gaggtgggcttcctggtgggcgagatcaccgacgaggggtacctgtcgctgcgcaaggta
ggtggcctggatgaccgggtgctccccggccggcaggtgtgggtgacccaccggcgcatc
cccggcgtgatcggcgccaaggcctggcacctctgcagccccgaggagcgcgggaaggtc
atccccttcgacgagatgtacgtcgacctgggctgccggtcccgggccgaggtggaggcg
ctgggcatcgagctcggggatccggtctactttgccaccgagttcgagctgctgggcgac
cgggtggccaagggcaaggccctggacgaccgggtgggctgcacggtgctcgcccgggtg
ctgctggagtacgacttccccggcatcaccctgctgggggcgttcaccacccaggaggag
gtggggctccggggtgcgaaggcggcggctttccacctgaaccccgacgtcgccctggcc
ctggaggggaccggctcggccaacgtggccggggtcgacccgtttgacaccatcaccaac
atgggggagggaccggtgatctcgctgatggacgcggccggcatcccccacaagcgggtc
caggaggagctgatccgcctggcccggaagcacggcatccggcaccagttccggcggctg
acctcgggcggtaccgacgccggggccatcgcccggtcgcggcagggcgtgcccgcctgc
acgatttcggtgccctgccgctacattcacaccaacgccgccctctgccacctcgacgac
gtcgacggcgcggtgcagctggtccggcggttcctggaaagcgtggagaagggggagttc
cgcccatga

DBGET integrated database retrieval system