KEGG   Symbiobacterium thermophilum: STH1081Help
Entry
STH1081           CDS       T00196                                 

Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sth  Symbiobacterium thermophilum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STH1081
Enzymes [BR:sth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     STH1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1195081..1196088
Genome map
AA seq 335 aa AA seqDB search
MSEKLLERVRELARLWGPSGREQRVHDALKAQIAPFVDEVRTDGFGNLLAVRKGREGGRR
VLLSAHMDTPGAIALNVTDKGLIYLAPVGGLKVHHAVGQRVVWGSGALGVLQYEHVEEPK
DLSFRKLFCDIGAATKEEALERVSLGDMCTLAGTVEAWGDLVVGPGLDNRLGCAVLLEVA
ERLGSGPHTVIFAFTAQGEVAPRGAAVAAFGAEPDVAVLVDSAVSGDQPGVRQVATRLGG
GPALRLKDSGFMAHHGLAAQIAAAAEAGGIPLQRCVSPTGSEGWTVTPVGPGVPTAVIDI
PVRYPGTGGEMADLRDARAAAELLLHFLGLPLNLA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagctgctggagcgcgtgcgggagctggcccggctctgggggccgtcgggc
cgtgagcagcgggtgcacgacgccctgaaggcgcagatcgcacccttcgtggacgaagtc
cgcacagacgggttcggcaatctgctggccgtgcggaagggcagggagggcggccgacgg
gtgctgctctccgcccacatggacaccccgggggccatcgccctcaacgtgaccgacaag
gggctgatctacctcgccccggtgggcgggctgaaggtccaccatgcggtggggcagcgg
gtcgtctggggcagcggcgccttgggcgtcctgcagtatgagcacgtggaggagccgaag
gacctgagcttcaggaagctcttctgcgacatcggcgccgcgacgaaggaggaagccctg
gaacgggtgtccctgggcgacatgtgcaccctcgccggcacggtggaggcatggggcgac
ctggtggtgggccccggcctggacaaccggctgggctgcgcggtgctcctggaggtcgcc
gagcggctgggcagcggtccgcacacggtgatcttcgccttcacggcgcagggcgaggtg
gccccgcggggggcggcggtggcggccttcggcgccgagcccgacgtggccgttctcgtc
gactcggccgtgagcggcgaccagcccggcgtccggcaggtcgccacccggttgggcggc
ggtcccgccctgcggctcaaggattcgggcttcatggcccaccacgggctcgcagcgcag
atcgccgccgcggccgaggccggggggataccgctgcagcgttgcgtcagtcccaccggc
agtgagggctggacggtgacccccgtcggccccggggtgcctacggcggtgatcgacatc
cccgtgcggtacccgggaaccggcggggagatggccgatctccgcgacgcccgggccgcg
gcggagctgctgttgcacttcctgggccttccgcttaatctggcctga

DBGET integrated database retrieval system