KEGG   Symbiobacterium thermophilum: STH1081Help
Entry
STH1081           CDS       T00196                                 

Definition
(GenBank) endo-1,4-beta-glucanase
Organism
sth  Symbiobacterium thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1195081..1196088
Genome map
AA seq 335 aa AA seqDB search
MSEKLLERVRELARLWGPSGREQRVHDALKAQIAPFVDEVRTDGFGNLLAVRKGREGGRR
VLLSAHMDTPGAIALNVTDKGLIYLAPVGGLKVHHAVGQRVVWGSGALGVLQYEHVEEPK
DLSFRKLFCDIGAATKEEALERVSLGDMCTLAGTVEAWGDLVVGPGLDNRLGCAVLLEVA
ERLGSGPHTVIFAFTAQGEVAPRGAAVAAFGAEPDVAVLVDSAVSGDQPGVRQVATRLGG
GPALRLKDSGFMAHHGLAAQIAAAAEAGGIPLQRCVSPTGSEGWTVTPVGPGVPTAVIDI
PVRYPGTGGEMADLRDARAAAELLLHFLGLPLNLA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagctgctggagcgcgtgcgggagctggcccggctctgggggccgtcgggc
cgtgagcagcgggtgcacgacgccctgaaggcgcagatcgcacccttcgtggacgaagtc
cgcacagacgggttcggcaatctgctggccgtgcggaagggcagggagggcggccgacgg
gtgctgctctccgcccacatggacaccccgggggccatcgccctcaacgtgaccgacaag
gggctgatctacctcgccccggtgggcgggctgaaggtccaccatgcggtggggcagcgg
gtcgtctggggcagcggcgccttgggcgtcctgcagtatgagcacgtggaggagccgaag
gacctgagcttcaggaagctcttctgcgacatcggcgccgcgacgaaggaggaagccctg
gaacgggtgtccctgggcgacatgtgcaccctcgccggcacggtggaggcatggggcgac
ctggtggtgggccccggcctggacaaccggctgggctgcgcggtgctcctggaggtcgcc
gagcggctgggcagcggtccgcacacggtgatcttcgccttcacggcgcagggcgaggtg
gccccgcggggggcggcggtggcggccttcggcgccgagcccgacgtggccgttctcgtc
gactcggccgtgagcggcgaccagcccggcgtccggcaggtcgccacccggttgggcggc
ggtcccgccctgcggctcaaggattcgggcttcatggcccaccacgggctcgcagcgcag
atcgccgccgcggccgaggccggggggataccgctgcagcgttgcgtcagtcccaccggc
agtgagggctggacggtgacccccgtcggccccggggtgcctacggcggtgatcgacatc
cccgtgcggtacccgggaaccggcggggagatggccgatctccgcgacgcccgggccgcg
gcggagctgctgttgcacttcctgggccttccgcttaatctggcctga

DBGET integrated database retrieval system