KEGG   Symbiobacterium thermophilum: STH1118Help
Entry
STH1118           CDS       T00196                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sth  Symbiobacterium thermophilum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH1118
   00030 Pentose phosphate pathway
    STH1118
   00051 Fructose and mannose metabolism
    STH1118
   00052 Galactose metabolism
    STH1118
   00500 Starch and sucrose metabolism
    STH1118
   00520 Amino sugar and nucleotide sugar metabolism
    STH1118
  Nucleotide metabolism
   00230 Purine metabolism
    STH1118
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STH1118
Enzymes [BR:sth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     STH1118
    5.4.2.8  phosphomannomutase
     STH1118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1243462..1244895)
Genome map
AA seq 477 aa AA seqDB search
MTQTISPLPEVIFREYDIRGVYGRTITDETARLVGRAFARLARERGFREVLVGRDNRLSS
PALARALTEGITREGLDVLDIGQVVTPVLYWAREFYGIDPAVMITASHNPGDENGFKLCL
GPGTLYGEAIQDLRRRAGALADASPEAEMDPRGGTGPAAGAGRVRTRDPIPSYCEMIAGR
VALHRPLKVVVDAGNGTAGPIAPGLFQALGCEVIPLYCESDPTFPNHHPDPVRPENLQDL
IRTVRETGADLGLAFDGDGDRLGVVDDQGQILWGDQLMILFWREILPRYPGATALVEVKC
SQALVEEIERLGGRPQFHRTGHSYVKKSLRELGGPFAGEMSGHLFFADGYYGFDDALYAG
ARLCRLVAESGRPLSALWADVPRYPSTPEIRVDCPEERKAAVVEGVVRHFRDRYEVLTVD
GARVLFPGGWGLVRASNTQPVLVLRCEGRSTEDLERVKAEMAEALARFPELGPVSWE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacaatttccccgctgccggaggtcatcttccgggagtacgacatccgcggc
gtgtacggcaggacgatcaccgatgagacggcccgcctggtcgggcgggccttcgcccgg
ctcgcccgggagcggggcttccgcgaggtgctggtggggcgggacaaccggctctcgtcc
cccgccctcgcccgggcccttacggagggcatcacccgcgaggggctggacgtgctggac
atcgggcaggtggtcacccccgtgctctactgggctcgggagttctacggcatcgacccg
gcggtcatgatcaccgccagccacaaccccggcgacgagaacggttttaagctctgcctc
ggccccggcacgctttacggggaagcgatccaggatctccgccgcagggccggggccctg
gcagacgcctcccccgaggcggagatggatccgcgaggcgggactggccccgcggcagga
gcgggccgggtgcgcacccgagacccgatccccagctactgcgagatgatcgccggccgg
gtggcactccaccgccccctgaaagtagtggtggacgccggcaacggcaccgccggcccc
atcgcacccgggctcttccaagcgctgggctgtgaggtcatccccctctactgcgagtcg
gaccccaccttcccgaaccatcatccggatccggtgcggcccgagaacctgcaggacctg
atccgcacggtccgggagaccggggcggacctggggctggccttcgacggcgacggcgat
cggctgggcgtcgtggacgaccagggccagatcctctggggcgaccagctcatgatcctc
ttctggcgggagatcctcccccgctaccccggcgccaccgccctggtggaggtcaagtgc
tcccaggccctggtggaggagatcgagcggctgggcggccggccgcagttccaccggacg
ggccattcctacgtgaagaagagcctgcgggagctgggcggccccttcgccggcgagatg
tcgggccacctcttcttcgccgacggctactacggcttcgacgatgccctctacgccggg
gcccggctctgccggctggtggcggagagcggccggccgctgtcggcgctgtgggcggac
gtgccccggtacccgtccacccccgagatccgggtggactgcccggaggagcgcaaggcc
gcggtggtcgagggcgtggtgcggcacttccgggaccggtacgaggtgctgacggtggac
ggcgcgcgggtcctcttccccggcggctgggggctggtccgggcgtccaacacccagccg
gtgctggtgctccggtgcgaggggcgctcgaccgaggacctggagcgggtgaaggcggag
atggccgaagccctggcccgcttcccggagctgggccccgtaagttgggagtag

DBGET integrated database retrieval system