KEGG   Symbiobacterium thermophilum: STH1160Help
Entry
STH1160           CDS       T00196                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sth  Symbiobacterium thermophilum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STH1160 (ruvA)
Enzymes [BR:sth01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     STH1160 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1290392..1291009
Genome map
AA seq 205 aa AA seqDB search
MIAHLRGELVTAGADWVVIDVAGVGYRCLVPASTRSRLPAQGAAVQLYTYLQVREDALTL
YGFLTQAEYDLFELLLRVDGVGPKVALAVLSTTDPAAFRRAVAFEDLDAICRVPGIGRKT
AQRLVLELKDKIGAVPAGGGGVPDGLPVAVAPAGDAWAEASEALIALGYSRGEAAAALAR
VRAEAGEAPSVETLVRLALKQLYRG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgattgcacatctgcgcggcgagctggtaaccgccggcgccgactgggtcgtcattgat
gtggcgggggtgggctaccgctgcctcgtccccgcctccacgcggtcgcgcctgccggcc
cagggcgccgcggtgcagctgtacacctacctgcaggtgcgggaggacgccctgaccctg
tacggctttctgacccaggccgagtacgaccttttcgagttgctgctgcgggtggacggc
gtcgggcccaaggtggccctcgcggtgctctccaccacggatcccgcagcgttccggcgg
gcggtggcgttcgaggacctcgacgccatctgccgggtgcccggcatcggccggaagacg
gcccaacggctggtgctggagctgaaggacaagatcggcgccgtgcccgccgggggcggg
ggggttcctgacggcctgcccgtcgcggtggctccggccggcgacgcctgggccgaggcg
tccgaggcgctcatcgcgctggggtacagccgcggcgaggcggctgcggccctggcccgg
gtgcgggccgaggccggcgaggcgccgtcggtggagaccctggtccgcctggctctgaag
caactctaccgggggtaa

DBGET integrated database retrieval system