KEGG   Symbiobacterium thermophilum: STH1195Help
Entry
STH1195           CDS       T00196                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sth  Symbiobacterium thermophilum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    STH1195
Enzymes [BR:sth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     STH1195
Exosome [BR:sth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STH1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1325225..1326721)
Genome map
AA seq 498 aa AA seqDB search
MNKGYVLALDQGTTSSRAILFNRDGRLVGQVNHEFRQIYPQPGWVEHDPREIWSTQLRAV
QDVLARTGVRLSEVAAIGITNQRETTVVWDAETGEPVYNAIVWQCRRTAPICAELAARGW
APRIREKTGLVIDAYFSGTKVKWILDNVPGVREKAEQGRLRFGTIDAWLIWNLTGGRVHA
TDYSNASRTMLFNIHQLAWDEEILHELGIPASLLPRALPSSHVYGETDPAVLGAAIPIAG
VAGDQQAALFGQACFQPGDAKNTYGTGCFMLMNTGDRAVPSESGLLTTIAWGIGDRVEYA
LEGSIFIGGAAVQWLRDELRFFDRAADSEALALSVPDSGGVYVVPAFVGLGAPYWDMYAR
GIVVGLTRGTGRAHITRATLESIAYQTRDVLGAMEKDSGIRLNRLKVDGGAVANNFLMQF
QSDILGVPVERPKIAETTALGAAYLAGLATGFWRSQAELADKWALDRGFTPALPAEERER
LYAGWRRAVERARGWAAE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagggttacgtcctcgccctggaccagggaaccacctcttcccgggccatcctc
ttcaaccgggacggccggctcgtggggcaggtgaaccatgagttccggcagatctacccg
cagcccggctgggtcgagcacgacccccgggagatctggtccacccagctgcgcgccgtc
caggacgtgctggcccgcaccggcgtccggctgagcgaggtggccgcgatcggcatcacc
aaccagcgggagacgacggtggtgtgggacgccgaaaccggcgagcccgtgtacaacgcg
atcgtctggcagtgccgccgcaccgcccccatctgcgccgagctggcggcgcggggctgg
gcgccgcgcatccgggagaagaccggcctggtcatcgacgcctacttctcgggaaccaaa
gtgaagtggattctggacaacgtccccggcgtgcgggagaaggcggagcaggggcggctg
cgcttcggcaccatcgacgcctggctcatctggaacctgaccggcgggcgggtgcacgcc
accgactactccaacgcctcccgcaccatgctgttcaatatccaccagctcgcgtgggac
gaggagatcctgcacgaactcggcatcccggcgtcgctgctaccccgggccctcccctcc
agccacgtctacggggagaccgatcccgcggtgctcggcgcggccatccccatcgccggc
gtggcgggggaccagcaggcggcgctcttcgggcaggcctgcttccagccgggcgatgcc
aagaacacctacgggaccggctgcttcatgctgatgaacaccggcgaccgggcagtgccg
tcggagagcggtctgctcaccaccatcgcctggggcatcggcgaccgggtggagtatgcg
ctggagggctcgatcttcatcggcggcgcggcggtgcagtggctgcgggacgagctccgc
ttcttcgaccgcgcggccgattccgaggccctggccctctccgtccccgactcgggcggg
gtgtacgtggtgccggccttcgtgggcctcggagctccgtactgggacatgtacgcccgc
ggcatcgtcgtgggcctcacccggggcacgggccgggcccacatcacccgggccacgctg
gagtccattgcgtaccagacccgcgacgtgctgggggcgatggagaaggactcgggcatc
cggctgaaccggctgaaggtggacggcggtgccgtcgccaacaacttcctcatgcagttc
cagtccgacatcctcggcgtaccggtcgagcggccgaagatcgcggaaaccacggccctg
ggtgcggcctacctggccggcctggcgaccggcttctggcgcagccaggcggaactggcc
gacaagtgggccctggaccggggcttcaccccggccctgccggccgaggagagagaacgg
ctctacgccggctggcgacgggcggtggagcgcgcccggggctgggccgccgagtag

DBGET integrated database retrieval system