KEGG   Symbiobacterium thermophilum: STH1206Help
Entry
STH1206           CDS       T00196                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sth  Symbiobacterium thermophilum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STH1206
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STH1206
Enzymes [BR:sth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     STH1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1341917..1343410
Genome map
AA seq 497 aa AA seqDB search
MRVKDCLVVGQLLQGDPAAEITDVVYDSRQVTPGALFVALPGRNVDGHDFAPEAVQRGAA
ALVVERPVAAPAHVAVIRTDSTRAALGRLAAEFWRHPSRRMRVVGVTGTNGKTTTTHLVK
AVLERQGHVVGLTGTVHTLMPGERRPAGLTTPEASDLQRLFHQMAEAGCTYAVMEASSQG
LDMNRVDDVEFDLGIFTNLTQDHLDYHGTFGAYREAKAKLFRLLSRPGYKPRKAAVLNAD
DPASEYYRSVTEVPVYTYGFRPDAMVRAADVELSPAGTRLRLCTPQGEVPVSLRLVGRFN
VYNALAAAAAGVAEGIALDVIRDALEAEEGVPGRLQPVRAGQPFGVFVDYAHSPDSLENV
LHTARGFTRGRLIVVFGCGGDRDPTKRPVMGRIAGCLAHHTIVTSDNPRSEDPVRIVQQI
ESGLVDGLLPGHTYEVVIDREEAIRRAVTMAEPDDVIVIAGKGHETYQIFKDRTIPFDDR
AVARSLIEARVGKGGSS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaaggattgcctggttgtgggccaactgcttcagggggacccggcggcagag
atcaccgacgtcgtctacgattcgcggcaggtgacgcccggcgccctgtttgtcgccctg
cccgggcggaacgtcgacggccacgactttgctccggaggcggtgcagcggggggcggcg
gccctggtggtggagcgtcccgtcgcggcgcctgcccacgtggccgtcatccggaccgac
tcgacccgtgccgccctgggccggctggccgccgagttttggcgccacccttcccgccgg
atgcgggtggtcggggtgacagggaccaacggcaagacgacgaccacacacctggtcaag
gccgtcctggagcggcagggccacgtggtcgggctcaccggtacggtgcacacgctgatg
cccggggagcggcggccggcagggctgacgacccccgaagcctcggacctgcagcggctt
ttccaccagatggcggaggccggctgtacctatgcggtcatggaagcctcctcgcaggga
ctcgacatgaaccgtgtagatgatgtagagtttgaccttgggatattcacgaacctgacc
caggatcacctggactatcacggcaccttcggcgcctaccgggaggccaaggcgaagctc
ttccgcctgctgagccgccccggttacaagccccgcaaggccgccgtgctcaatgccgac
gacccggccagcgagtactaccgctccgtcaccgaggtgcccgtctacacctacgggttc
cgccccgatgccatggtccgggccgcggacgtggagctgagcccagccggcacccggctc
cggctctgcacgccgcagggggaggtgccggtcagcctgaggctcgtgggccggttcaac
gtatacaacgccctggccgctgctgcggccggcgtggccgagggcatcgcgctcgacgtg
atccgcgacgcgctggaggccgaggagggggtgcctggccggctgcagccggtccgggcc
ggccagcccttcggggtcttcgtggactacgcccactccccggactccctggagaacgtg
ctgcacaccgccaggggcttcacccggggccggctgatcgtcgtcttcgggtgcgggggc
gaccgggaccccaccaagcgacccgtcatggggcgcatcgccgggtgcctggcgcaccac
accatcgtcacctccgacaacccgaggagcgaggacccggtccgcatcgtccaacagatt
gagtccggcctggtggacggccttctgcccggccacacctacgaggtggtcatcgaccgg
gaagaggcgatccgccgggcggtgaccatggccgagccggatgacgtcatcgtcatcgcc
ggcaaggggcacgagacgtaccagatcttcaaggaccgcaccattcccttcgacgaccgg
gcggtggcccgctcgttgatcgaggcgcgcgtcggaaagggcggatcgagttga

DBGET integrated database retrieval system