KEGG   Symbiobacterium thermophilum: STH1212Help
Entry
STH1212           CDS       T00196                                 

Definition
UDP-N-acetylglucosamine enolpyruvyl transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sth  Symbiobacterium thermophilum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sth00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sth00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349289..1350614
Genome map
AA seq 441 aa AA seqDB search
MDRPAGLRLRPREVACIVKPNERYVVAGGCRLQGEVPVSGAKNAALPILAAALLTSGESV
IHNAPMIRDVAVMIEILHKLGARVEEGPEGVSGRTLRIRADGLNGQEVGADFTREMRSSI
FLMGPLLARVGKIRISYPGGCAIGPRPIDFHLRGLEALGARIEERFGYIEASVPRRLRGT
EIYLDFPSVGATENLMMAAVLAEGTTVIRNAAREPEIVDLQAFLNKMGARVRGAGLDVIR
IDGVSKLGSVEHTVIPDRIEAATFLAAAAITGGEVTVQGVIPEHVDAVTAKLREMGTTIR
EYGTAVTAVGPRRLKAADVKTLPYPGFPTDMQPQMMALAATADGTSIITETIFENRFKVA
DELRRMGANIKTEGRTAVVQGVPSLSGATVVCPALREGMALILAGLRAEGETTIEDIYHI
DRGYQHLEQKLTRLGATISRV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggaccggcctgccggcctgcggctccggccgcgggaggtcgcatgcatcgtgaagcca
aatgagcgctacgtggtcgcaggggggtgccgcctgcagggcgaggtgccggtcagcgga
gcgaagaacgccgccctgccgatcctggcggcggcgctcctgacgtccggcgagtcggtg
atccacaacgcgccgatgatccgcgacgtggcggtgatgatcgagatcctgcacaagctg
ggggcccgggtggaggaggggcccgagggcgtctcgggacgcaccctgcgcattcgggcg
gacggcctgaacggccaggaggtgggggcggacttcacccgggagatgcgctcctccatc
ttcctgatgggaccgctcctggcccgggtcggcaagatccgcatctcctatcccggcggc
tgtgcgatcggcccgaggccgatcgattttcatctccgcgggctggaggccctgggcgcc
cgcatcgaggagcggttcggctacatcgaggccagcgttccccggcggctccgggggact
gagatctacctggacttcccctccgtcggcgccacggagaacctgatgatggcggccgtg
ctggcggagggcaccacggtgatccgcaacgcggcacgggagccggagatcgtggacctg
caggcgttcctcaacaagatgggcgcgcgggtgcgcggggccgggctcgacgtgatccgg
atcgacggcgtgagcaagctgggttcggtggaacacaccgtgattcccgaccgcatcgag
gccgccaccttcctggcggccgcggcgatcaccggcggggaggtgaccgtgcagggggtg
atccccgagcacgtggacgcggtgaccgcgaagctgcgggagatgggcaccaccatccgg
gagtacggcaccgcggtcacggcggtggggccccggcggctgaaggcggcggacgtcaag
accctgccctacccgggtttccccaccgacatgcagccgcagatgatggccctggcggcc
accgccgacggcaccagcatcatcacggagaccattttcgagaaccggttcaaggtcgcc
gacgagctgcgccggatgggcgccaacatcaagaccgagggacggaccgcggtggtgcag
ggggtgccgtccctctcgggagcgacggtggtctgcccggcgctgcgggaggggatggca
ctgattctcgccggcctccgggcggagggcgagaccaccatcgaggacatctaccacatc
gaccggggctaccagcacctggagcaaaagctgacccggctgggggcgacgatcagccgg
gtgtag

DBGET integrated database retrieval system