KEGG   Symbiobacterium thermophilum: STH1339Help
Entry
STH1339           CDS       T00196                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sth  Symbiobacterium thermophilum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sth00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484759..1485394
Genome map
AA seq 211 aa AA seqDB search
MPNKPKGLLIVVTGPSAVGKGTICRALLAETPGIRFSVSCTTRPKRPGEVDGVEYYFISK
EEFERRIAAGEFLEWAEVYGNYYGTPRGYVEEVTAQGQDVILDIDRVGARAVREQYPDAV
SVFVIPPSMEALRQRIAARGTESPEAVARRLAEAPEWIREGLTYDYVIVNDDLARAVAEL
RAIIMAEKARTVRNGAALIETLLEKGALTDE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcccaataagcccaagggactcctgatcgtggtcaccgggccgtctgccgtcggcaag
ggtaccatctgccgggccctgctggcggagaccccgggcattcgcttctcggtatcctgc
acgacccgtcccaagcgtcccggcgaggtcgacggcgtagagtactactttatttccaag
gaagagttcgagcgccgcatcgcagccggggagttcctggagtgggcggaggtatacggg
aactattacggtacgccccggggctacgtggaagaggtgaccgcccaggggcaggatgtc
atcctcgacatcgaccgggtcggcgcgcgggcggtgcgtgagcagtacccagacgccgtc
tccgtcttcgtgatcccgccgtccatggaggcgctgcgccagcgcatcgccgctcgcggc
accgagtcgcccgaggcggtggcgcgccggctggcggaggcgccggaatggatccgggaa
gggcttacatacgattacgtcatcgtcaacgacgacctggcgcgcgccgttgccgagctg
cgggccatcatcatggcggagaaggccaggacggtccggaacggcgccgcgttgatcgag
acgttgcttgagaagggagcgctgaccgacgaatga

DBGET integrated database retrieval system