KEGG   Symbiobacterium thermophilum: STH1412Help
Entry
STH1412           CDS       T00196                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sth  Symbiobacterium thermophilum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sth01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sth00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1558280..1559092
Genome map
AA seq 270 aa AA seqDB search
MAAARRARPLADVIAAARAAPPPRGFLRALGGPPSGAGAGGTEVRVIAEVKKASPSKGVI
RPDFDPVAIARAYAEGGAACLSVLTDERYFQGSLAYLAAIREAVALPLLRKDFIIEEYQV
HEARAAGADAILLIVAAFCGDCAGGRTPEDLNRLAALARELGMDVLTEVHTADELALAVA
SGAPLIGINNRDLRTFHTTLEVTERLAPLVPPDRLLVSESGIWTHDDLRRVAAAGARAVL
VGESLMRQPDVAAALRALRGSPEGSVPDNS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcggcccggcgggcccggcccctggcggacgtgatcgccgccgcccgcgccgcc
cctccgccccgggggttcctgcgggccctggggggaccgccgtccggggccggggcgggc
gggaccgaggtccgggtcatcgccgaggtgaagaaggccagcccttccaagggggtgatc
cggccggatttcgacccggtggccatcgcccgggcctatgccgagggcggagcagcctgc
ctctccgtgctcacggacgagcggtactttcagggctcgctggcgtacctcgcggccatc
cgggaggcggtggcgctgccgctcctgcggaaggacttcatcatcgaagagtaccaggtc
cacgaggcccgggcggcgggggcggacgccatcctgctgatcgtggcggccttctgcggc
gactgcgccggaggccgcacgccggaggacctgaaccggctggcggcgctggcgcgggag
ctgggcatggacgtgttgacggaggtccacaccgccgacgagctggccctggcggtggcg
tccggcgctccgctgatcgggatcaacaaccgggacctgcggaccttccacaccacgctg
gaggtcacggaacggctggcgcccctggttccgcccgaccggctgctggtgagcgagtcg
ggcatctggacccacgacgacctgcgccgggtcgcggccgcaggcgcacgagcggtgctg
gtgggggaatcgttgatgcgccagcccgacgtggccgccgcgctgcgggcgctgcggggg
tcgcctgaaggctcggtgccggacaacagttga

DBGET integrated database retrieval system