KEGG   Symbiobacterium thermophilum: STH1414Help
Entry
STH1414           CDS       T00196                                 

Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sth  Symbiobacterium thermophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STH1414
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STH1414
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STH1414
Enzymes [BR:sth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STH1414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1559846..1560976
Genome map
AA seq 376 aa AA seqDB search
MAACIELEEAYRRYKDDPEFLEELTYYRRQYVGRPTPLYFAERLTRHAGGARIYLKREDL
NHTGAHKINNALGQALLARRMGKKRIIAETGAGQHGVAAATVAALFGMECDVHMGEVDVA
RQRLNVFRMQLLGARVIPTRSGSRTLKDATNEAIRDWVTNVETTHYVIGSAVGPHPYPMI
VRDFQAVIGYETMSQIQEAEGRLPDAVVACVGGGSNAIGIFHPFVPFPEVRLVGTEAGGL
GIGSGKHGATLSGGGEVGVFHGARTYLLQDAYGQVQEAHSISAGLDYPGVGPEHAYLRDT
GRAEYVAVTDEQALEGMQLLSRTEGIIPALESSHAVYYGVRLAAGMAPDQIVVINLSGRG
DKDMAEVARILGGEGA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctgcatcgaactggaggaggcgtaccggcgctacaaggacgaccccgagttc
ctggaggagctcacctattaccggaggcagtacgtgggccggccaacgccgctttacttc
gccgagcggctgacccggcacgccggcggggcgaggatctacctgaaacgggaggacctg
aaccacaccggcgcccacaagatcaacaacgccctcggccaggccctgttggcccggcgg
atgggcaagaagcgcatcatcgccgagaccggcgccggccagcacggcgtggccgcggcc
accgtggcggccctgttcgggatggagtgcgacgtccacatgggggaggtggacgtggcc
cgccagcggctgaacgtcttccgcatgcagctgctcggggcccgggtgatcccgacccgg
tcggggtcccgcaccctgaaggacgccaccaacgaggcgatccgggactgggtgaccaac
gtggagacgacccattacgtgatcggctccgcggtggggccgcacccgtacccgatgatc
gtgcgggacttccaggcggtgatcggctacgagaccatgagccagatccaggaggcggag
gggcggctgcccgacgcggtcgtcgcgtgcgtgggcgggggatccaacgccatcgggatc
ttccaccccttcgtgcccttccccgaggtccggctggtggggacggaggccggcggcctg
gggatcggcagcggcaagcacggggcgacgctgagcggcggcggtgaggtgggcgtcttc
cacggcgcccgcacctacctgctgcaggatgcgtacggccaggtgcaggaggcccactcc
atctccgccgggctggactatcccggcgtggggccggagcacgcctacctccgggacacc
ggccgcgccgagtacgtggcggtgacggacgagcaggcgctggagggcatgcagctgctc
agccggaccgaggggatcatcccggccctggagtccagccacgccgtgtactacggcgtc
cgcctggccgccgggatggcgccggaccagatcgtggtcatcaacctgtcggggcggggt
gacaaggacatggccgaggtcgcccgcatcctggggggtgaaggggcatga

DBGET integrated database retrieval system