KEGG   Symbiobacterium thermophilum: STH1415Help
Entry
STH1415           CDS       T00196                                 

Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sth  Symbiobacterium thermophilum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STH1415
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STH1415
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STH1415
Enzymes [BR:sth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STH1415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1560973..1561812
Genome map
AA seq 279 aa AA seqDB search
MSRIAERFALLRSRGEKGLIAYLAAGDPSLATTRRLVHALAEAGVDMVELGLPFSDPLAD
GPVIQAASQRALAAGANTDNVLELVAALRADGLQIPLLIMTYYNLVLRPGVENFCHRAAA
AGVDGLILPDVPVEESDEIRAAAGAVGLDLIQFVAPTSPPERIRRAAELARGFIYAVSST
GVTGVRDRLPPQLTAMVEAVKAVTDTPVAVGFGISRPEQVRQVTAVADAAIVGSAFVRHC
GEGLPEHELVERVRILAEELKAGTRPGTGWDSRFVKNEA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgccgaacggttcgccctgctgcgcagtcggggggagaaggggctcatc
gcctacctggccgccggcgacccctccctggccaccacccgcaggctggtgcacgccctc
gcggaggcgggggtggacatggtcgagctgggcctgccgttttccgacccgctggccgac
ggtccggtgatccaggcggccagccagcgggccctggcggccggcgccaacaccgataat
gtgctggaactggtcgcggcattgcgcgccgacgggttgcagataccgctgctgatcatg
acatactacaacctggtgttgcggccgggggttgagaacttctgtcaccgtgcggccgca
gccggggtcgacggcctgatcctgcccgacgtgccggtggaggagagcgacgagatccgc
gccgcggccggggcggtagggctcgacctcatccagttcgtcgcccccacctcgccgccg
gagcggatccggcgggcggccgagctggcgcgggggttcatctacgccgtgtcgtccacc
ggcgtgaccggcgtgcgggaccggctgccgccgcagctcaccgccatggtggaggcggtg
aaggcggtcaccgacaccccggtggcggtgggcttcggcatctcccggcccgagcaggtg
cgccaggtcacggccgtggctgacgccgccatcgtcggatcggccttcgtgcgccactgc
ggcgaggggctgccggagcatgaactggtggagcgggtgcggatcctggcggaggagctg
aaggcgggcacccggcctggtacgggatgggacagccggtttgtgaaaaacgaggcttga

DBGET integrated database retrieval system