KEGG   Symbiobacterium thermophilum: STH15Help
Entry
STH15             CDS       T00196                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sth  Symbiobacterium thermophilum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    STH15 (recR)
DNA repair and recombination proteins [BR:sth03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      STH15 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18297..18893
Genome map
AA seq 198 aa AA seqDB search
MYYAEPIARLIEELTKLPGIGPKTAQRLAFHILHMEPSVVEGIARTLVEARAKVKYCSVC
CNLTDQDPCQICADDGRDHSTICVVQEPRDVVAMEKTREYHGVYHVLHGALNPMEGIGID
DIRVKELVARLGDGRVQEVILCTNPNTEGETTAMYIARYIKPLGVKVTRIARGLPMGGDL
EYADEVTLAKALEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtactacgccgagcccatcgcccgcctgatcgaggagctgacgaagctgccggggatc
ggccccaaaaccgcgcagcggctcgcctttcacatcctccacatggagcccagcgtggtc
gaggggatcgcccgcacgctggtggaagcccgcgcaaaggtgaagtactgttcggtctgc
tgcaacctgaccgaccaggatccctgccagatctgcgccgacgacggccgcgaccacagc
accatctgcgtcgtgcaggagccgcgcgacgtcgtggcgatggagaagacccgggagtac
cacggggtgtaccacgtgctccacggcgccctgaacccgatggaggggatcggcattgac
gacatccgggtgaaggagctggtggcccgcctgggcgacgggcgggtgcaggaggtcatc
ctgtgcaccaaccccaacaccgagggcgagaccacggcgatgtacatcgcccggtacatc
aagccgctgggcgtgaaggtcacccgcatcgcccgtggcctgcccatgggcggcgacctg
gagtacgccgacgaggtgacgctggccaaggccctggaggggcgccgggagatctag

DBGET integrated database retrieval system