KEGG   Symbiobacterium thermophilum: STH1541Help
Entry
STH1541           CDS       T00196                                 

Gene name
cheB
Definition
chemotaxis protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sth  Symbiobacterium thermophilum
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sth00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    STH1541 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    STH1541 (cheB)
Enzymes [BR:sth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     STH1541 (cheB)
Two-component system [BR:sth02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   STH1541 (cheB)
Bacterial motility proteins [BR:sth02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    STH1541 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1677207..1678295
Genome map
AA seq 362 aa AA seqDB search
MSDRVQRPIRVLVVDDSAFMRKVLTELLESDPLITVVGTARDGQDGLEKVLQLQPDVVTL
DIEMPRLDGYGTLREIMARRPTPVVMVSSHTREGAEATIRALALGAVDFVAKPSGSISLN
MHVARDELVAKVKAAAAATPRVRTAAVELAPVSPREKMQALAGLRRQTGFGDRLPRRLVL
IGCSTGGPGALHQIIPRLPADLPAGVLVVQHMPPGFTRSLAQRLDELSAISVREARAGDP
VRAGQVLVAPGGYHMLVDAEGRIALDQGPPVHGVRPAVDVTFESVLPVWKERLVGVILTG
MGYDGAKGMAQLRKAGGWTIAEDASTCVVYGMPRVVVELGAAREVLPVHSIADAITRAVG
EG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgagtgcagcgcccgatccgcgtcctggtggtcgacgactccgccttcatg
cggaaggtgctgaccgagctcctggagtccgatccgctgatcacggtggtcggcacggcc
cgcgacgggcaggacggactcgagaaggtgctgcagctgcagccggatgtggtgacgctg
gacatcgagatgccccggctggacggctacggcaccctcagggagatcatggctcggcgg
ccgacgccggtggtgatggtttccagccacacccgggaaggggcggaggccaccatccgg
gctctggccctgggcgcggtggactttgtggccaagccgtcgggatccatctcgctgaac
atgcacgtggcccgggacgaactggtggcgaaggtcaaggcggccgctgcggccaccccg
cgggtgcgcaccgcggcggtggaactggcgccggtctccccgcgggagaagatgcaggcc
ctggcgggactgcgccgccagacggggtttggggaccggcttccccgccgcctggtcctg
atcggctgttccaccggcgggccgggcgccctgcaccagatcatcccccgcctgccggcg
gacctgccggccggggtgctggtggtccagcacatgccgcccgggttcacccggtcgctg
gcgcagcggctggacgagctctccgccatctcggtccgggaggcccgggccggggatccg
gtgcgggcgggccaggtcctggtggcgcccggcgggtatcacatgctggtggacgcggag
gggcggatcgccctggatcaggggccgccggtacacggcgtgcgcccggcggtggacgtc
accttcgagtcggtgctgcccgtctggaaggagcggctggtgggggtgattctcaccggc
atgggctatgacggggccaaggggatggcccagctgaggaaggcgggcggctggaccatc
gccgaggacgcttccacctgcgtcgtctacggcatgccgcgggtcgtcgtggaactgggg
gcggccagggaggtcctgcccgtgcatagcatcgccgatgcgattacgcgtgctgtagga
gagggttaa

DBGET integrated database retrieval system