KEGG   Symbiobacterium thermophilum: STH1541Help
Entry
STH1541           CDS       T00196                                 

Gene name
cheB
Definition
chemotaxis protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sth  Symbiobacterium thermophilum
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sth02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sth02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1677207..1678295
Genome map
AA seq 362 aa AA seqDB search
MSDRVQRPIRVLVVDDSAFMRKVLTELLESDPLITVVGTARDGQDGLEKVLQLQPDVVTL
DIEMPRLDGYGTLREIMARRPTPVVMVSSHTREGAEATIRALALGAVDFVAKPSGSISLN
MHVARDELVAKVKAAAAATPRVRTAAVELAPVSPREKMQALAGLRRQTGFGDRLPRRLVL
IGCSTGGPGALHQIIPRLPADLPAGVLVVQHMPPGFTRSLAQRLDELSAISVREARAGDP
VRAGQVLVAPGGYHMLVDAEGRIALDQGPPVHGVRPAVDVTFESVLPVWKERLVGVILTG
MGYDGAKGMAQLRKAGGWTIAEDASTCVVYGMPRVVVELGAAREVLPVHSIADAITRAVG
EG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccgagtgcagcgcccgatccgcgtcctggtggtcgacgactccgccttcatg
cggaaggtgctgaccgagctcctggagtccgatccgctgatcacggtggtcggcacggcc
cgcgacgggcaggacggactcgagaaggtgctgcagctgcagccggatgtggtgacgctg
gacatcgagatgccccggctggacggctacggcaccctcagggagatcatggctcggcgg
ccgacgccggtggtgatggtttccagccacacccgggaaggggcggaggccaccatccgg
gctctggccctgggcgcggtggactttgtggccaagccgtcgggatccatctcgctgaac
atgcacgtggcccgggacgaactggtggcgaaggtcaaggcggccgctgcggccaccccg
cgggtgcgcaccgcggcggtggaactggcgccggtctccccgcgggagaagatgcaggcc
ctggcgggactgcgccgccagacggggtttggggaccggcttccccgccgcctggtcctg
atcggctgttccaccggcgggccgggcgccctgcaccagatcatcccccgcctgccggcg
gacctgccggccggggtgctggtggtccagcacatgccgcccgggttcacccggtcgctg
gcgcagcggctggacgagctctccgccatctcggtccgggaggcccgggccggggatccg
gtgcgggcgggccaggtcctggtggcgcccggcgggtatcacatgctggtggacgcggag
gggcggatcgccctggatcaggggccgccggtacacggcgtgcgcccggcggtggacgtc
accttcgagtcggtgctgcccgtctggaaggagcggctggtgggggtgattctcaccggc
atgggctatgacggggccaaggggatggcccagctgaggaaggcgggcggctggaccatc
gccgaggacgcttccacctgcgtcgtctacggcatgccgcgggtcgtcgtggaactgggg
gcggccagggaggtcctgcccgtgcatagcatcgccgatgcgattacgcgtgctgtagga
gagggttaa

DBGET integrated database retrieval system