KEGG   Symbiobacterium thermophilum: STH18Help
Entry
STH18             CDS       T00196                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sth  Symbiobacterium thermophilum
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sth00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28313..29194
Genome map
AA seq 293 aa AA seqDB search
MSPRSLPGFPHIERLADFMAASDDYATARAVLWGIGQDFTTSYRPGTRFGPGRIREASYG
IEEFSYHSRMSLTDKNFFDLGDVAVVFGDVQESLRRAEEVARRLFADGKLSLMMGGEHLV
TLPVVKAAYEKYGDDLVLLQFDAHADLREDYLGNPLSHATVMRRCLDFLPAQNLYQFGIR
SGTREEYEFGTSRCHLFPHQVLEPLRQVIPTLGDRPVYVTIDIDVMDPAFAPGTGTPEPG
GITSREMIDAVLAMRGLNVVGLDVVEVAPGLDQTDRTPVLAAKLIREAILAFA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccgcgcagcctgcccggctttccgcacatcgagcggctggccgacttcatggcg
gcctccgacgactacgccaccgcccgggcggtgctctggggcatcggtcaggatttcacc
acttcgtaccgccccggcacccggttcggccccggccgcatccgggaggcctcctacggc
atcgaggagttcagctaccactcccgcatgagcctcaccgacaagaacttcttcgacctg
ggcgacgtggccgtcgttttcggcgacgtgcaggagtccctgcgccgggccgaggaggtg
gcgcgccggctcttcgccgacggcaagctctcgctgatgatgggcggcgagcacctggtg
acgttgccggtggtgaaggccgcttacgagaagtacggcgacgacctggtgctgcttcag
tttgacgcccacgccgacctgcgggaggactacctgggcaacccgctcagccacgcgacg
gtcatgcgccgctgcctggacttcctgcctgcgcagaacctgtaccagttcggcatccgc
agcggcacccgggaggagtacgagttcggcacgagccggtgccacctgttcccccaccag
gtcctggagccgctccggcaggtcatcccgacgctgggggaccggccggtatacgtcacc
attgacatcgacgtgatggacccggcctttgcgccgggcaccggcacgcccgagccgggc
ggcatcaccagccgggagatgatcgacgcggtgctggccatgcggggcctcaacgtcgtg
gggctcgacgtcgtggaggtggcgcccgggctggaccagaccgaccggacgccggtactg
gcggccaagctgatccgcgaggcgatcctggcgttcgcgtga

DBGET integrated database retrieval system