KEGG   Symbiobacterium thermophilum: STH188Help
Entry
STH188            CDS       T00196                                 

Definition
sugar isomerase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sth  Symbiobacterium thermophilum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    STH188
Enzymes [BR:sth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     STH188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213416..214708
Genome map
AA seq 430 aa AA seqDB search
MAVYRAQGVWPGEAEGRIVWVDPEWQPERAGCADRPAEIGRLREAVGRALHDLDAWMDRQ
PTLGGRVLLQHCREALQDPAFMERVTMLIDQHGLTAPAALMEAASLVGGIMARSEELRER
AAALRQTARWLARRLDGAAHPEDAILASRAFSALELLDRTRPAVMAAGEPVVVGDAPLLW
GVDAVAPEWAGRPARIRGGTLILGEEDEAGGLLHEAARRAVLAVARRMKAEGLVRMKEGN
VSCRIPGTSLFAVTPSGLPYESLEPADICILDLDGRVVDARRRPSTETALHRFVYRRRPD
VGGVVHTHSLHATAFACTGREIPVISTELAALVGAEVPCAPYAPAGTERLAEVVAEALGD
EGAAALLQNHGVVTVGETVEQAYAAAVAVEVAAQVFLLARQLGEPIVLPPEERRRIFRSM
RTGYGQPREA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccgtttaccgtgcgcagggggtatggcccggagaggctgaaggccgcatcgtctgg
gtggatccggagtggcagccggagcgggccgggtgcgcggacaggcccgcggagatcggg
cggctgcgggaggcggtcggccgcgcgctgcacgacctggacgcctggatggaccggcag
ccgaccctcggggggcgggtgctgctgcagcactgccgcgaggcccttcaggacccggcc
ttcatggagcgggtcaccatgctgatcgaccagcacggcctgacggccccggccgcgctg
atggaggcggcttccctggtgggcggcatcatggcccgcagcgaagagctgcgggagcgg
gcggcagccttgcggcagacggcccgctggctcgcccgtcggctggacggcgccgcgcac
cccgaggatgccatcctcgcgagccgcgccttctcggcgctggagctcctcgaccgcacg
cggccggccgtgatggccgccggcgagccggtggtggtgggcgacgcgccgctgctctgg
ggcgtggacgcggtggcgccggagtgggccggcaggccggcccggatccgcggcggcacg
ctgatcctcggcgaggaggacgaggccggcggcctcctgcacgaggccgcgcggcgggcg
gtcctggccgttgcccgccgcatgaaggcggaggggttggtgcggatgaaggagggcaac
gtctcctgccgcatcccgggaacctccctgttcgcggtcacccccagcggcctgccctac
gaatcgctggaaccggcggacatctgcatcctggacctggacggacgggtggtggacgcg
cggcggcggccctccacggaaacggctctgcaccggtttgtctaccggcggcgtccggac
gtgggcggggtggtgcacacccactccctccacgcgacggcctttgcctgcaccgggcgg
gagatccccgtgatctccacggagctggccgcgctggtgggggcggaggtcccctgtgcg
ccgtacgcccccgccggcacggagcggctcgcggaggtggtcgcggaggccctgggcgac
gagggcgccgccgcgctgctgcagaaccacggcgttgtcacggtcggggagacggtggag
caggcctacgcggccgcggtggcggtggaggtggccgcgcaggtcttcctgctggcgcgg
cagttgggggagccgatcgttcttccgccggaggagcgtcgacgcatcttccgctccatg
cgcaccggctacgggcagccccgggaggcatag

DBGET integrated database retrieval system