KEGG   Symbiobacterium thermophilum: STH1927Help
Entry
STH1927           CDS       T00196                                 

Definition
cobalamin biosynthesis protein
Orthology
K02227  
adenosylcobinamide-phosphate synthase [EC:6.3.1.10]
Organism
sth  Symbiobacterium thermophilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STH1927
Enzymes [BR:sth01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.10  adenosylcobinamide-phosphate synthase
     STH1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2070064..2071002)
Genome map
AA seq 312 aa AA seqDB search
MFPAAPWYLPLAALAVDAAVGDPARLPHPVALMGRVIAWAEPRLRRTRLPLRAAGVLLAL
LLPVAAWGLTWGLIRLAAALHPWLGVAAEVWLLSTCLAARSLADHALAVYRPLKAGDLSE
ARRRVAHIVGRDTAGLDAAEVTRATVETVAESTCDGVIAPLFWGLVGGAPLAMAYKAANT
LDSMVGHRNERYLEFGWASARLDDLVNLAPARLSALLLALAGLSPKALRIALRDAPRHPS
PNSGWPEAAMAALLRVQLGGLNHYGGRPERRAHMGDPLEMLQPGHIVQAVRWMWLATLLG
TGLGALTLWFLA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccgcggcgccctggtacctgccgctggcggccctcgcggtggacgcggcggtg
ggcgatcccgcccggctgccccatccggtggcgctcatgggccgggtgattgcgtgggcc
gagccgcgactgcggcggacgcggctgccgctgcgggcggccggggtgctgctggccctc
ctgctgccggtcgcggcctggggcctcacctgggggctcatccggctggccgcggccctg
catccctggctcggtgtggccgccgaggtctggctcctcagcacctgcctggcggcccgc
tctctggccgatcacgcactggcggtctaccgcccgctgaaggccggggacctcagcgag
gcgcggcgccgggtggcgcacatcgtcggcagggacacggccgggctggacgccgccgag
gtcacccgggcgacggtggagacggtggccgagtccacctgcgacggcgtgatcgcgccg
ctcttctgggggctggtcggcggcgcgccgctggcgatggcctacaaggccgccaacacc
ctggattcgatggtcggccaccggaacgagcgctacctggagttcggctgggcctccgcc
cggctggatgatctggtcaacctggcgcctgcccggctcagcgccctgctgctggccctg
gccggcctgagcccgaaggccctccgcatcgccctgcgggacgcgccgcgccaccccagc
cccaacagcggctggccggaggcggcgatggcggccctgctgagggtgcagctgggcggc
ctcaaccactacggcgggaggccggagcggcgggcccacatgggcgatccgctggagatg
ctgcagccgggtcacatcgtgcaggcggtgcggtggatgtggctggcgaccctgctcggg
acgggcctcggggcgctgacgctctggttcttggcgtga

DBGET integrated database retrieval system