KEGG   Symbiobacterium thermophilum: STH2045Help
Entry
STH2045           CDS       T00196                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sth  Symbiobacterium thermophilum
Brite
Enzymes [BR:sth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     STH2045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2183195..2184037
Genome map
AA seq 280 aa AA seqDB search
MSRKSRNCRNPPRSGDAQQRPRERSGSGMSTTPLQVLPGAEPLYSVGSRIGVLVSHGFTG
SPQSMRFLAEGFARAGYTVAMPRLTGHGTTPAEMAASTASDWTADIVAAMRWLEERCDVL
FMTGLSMGGALTVWAAGQFPERFAGIMPINAALRMESPDLAALAFNPDAPAELPGIGSDI
KAEGVKELAYPVTPVPAIKHLITIGAVAEMLLPRVKCPALIIQSREDHVVPPHNGELIYN
GIGSTEKELLWLENSYHVATLDNDKELILERSLAFIRKHS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggaaaagcaggaactgccggaaccctccgagaagcggagatgcacagcaacgt
ccccgcgaaaggagtggttccggtatgtcgacgacgccccttcaggtcctccccggcgca
gagccgctgtacagcgtcggcagccgcatcggggtcctcgtctcccacgggttcacgggt
tcaccgcagtcgatgcgcttcctggccgaaggcttcgcccgggcaggctacacggtggcc
atgccccgcctgacgggacacggtaccacgccggccgagatggcggcatccaccgcgtcc
gactggaccgcggacatcgtggcggcaatgcgctggctggaggagcggtgcgacgtcctc
ttcatgaccggcctctccatgggcggtgccctgacggtctgggccgcgggccagttcccg
gagcgattcgccggcatcatgcccatcaacgccgcgctccggatggagtcgcccgacctg
gctgcgctggccttcaacccggacgcgccggcggagctgccgggcatcggcagcgacatc
aaggccgagggcgtgaaggagctggcctatccggtgaccccggtgccggccatcaagcac
ctgatcaccatcggcgccgtcgccgagatgctcctgccccgggtcaagtgccccgccctg
atcatccagtcccgggaggaccacgtggtgccgccccacaacggcgagctgatctacaac
ggcatcggcagcaccgagaaggagctgctctggctggagaactcctaccacgtcgcgacc
ctggacaacgacaaagagctcatcctggagcgttcgctggcgttcatccggaagcacagc
tga

DBGET integrated database retrieval system