KEGG   Symbiobacterium thermophilum: STH2047Help
Entry
STH2047           CDS       T00196                                 

Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sth  Symbiobacterium thermophilum
Brite
Enzymes [BR:sth01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     STH2047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2184919..2185869)
Genome map
AA seq 316 aa AA seqDB search
MAVGCSSSSTKSTGQLTEVRQGSFATIVAAPENPDNPTTPEKVELGKLLFFDPRLSSSGV
ISCATCHNLGLAGTDRLPTSIGHGFQRTPRNAPTVLNAAFFQNQFWDGRAQGLEEQAKGP
IQAEAEMNMPADMAVERIKSIKGYHEYFEKAFPGEEDPITFDNIVKAIAAFERTLITPND
ALDRYLRGDKNALSPQAIRGMETFERIGCTSCHAGPALSSGAMMKFDWGSDPGKASWTNN
PQDEKFFRVQTLRNVSLTGPYFHDGSVETLEEAVTIMARVQLGYELSDQERDDIVAFLRS
LVGEMPQVEVPVLPAE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggccgttggctgcagctcgagctccaccaagtcgacgggtcagcttaccgaagttcgc
caaggcagcttcgccaccatcgtcgcagcgcccgagaacccggacaaccccaccaccccc
gagaaggtcgagctgggcaagctgctcttcttcgatccccggctcagcagcagcggcgtg
atctcctgcgcgacctgtcacaacctcgggctggccggcacggaccgtctcccgacctcg
atcggtcacggcttccagaggaccccgcgcaacgcccccacggtgctgaacgcggcgttc
ttccagaaccagttctgggacggccgcgcgcagggcctggaggagcaggcgaagggcccg
atccaggccgaggccgagatgaacatgcccgccgacatggccgtggagcggatcaagtcg
atcaagggctaccacgaatacttcgagaaggccttccccggcgaggaggatcccatcacc
ttcgacaacatcgtgaaggcgatcgccgccttcgagcgcaccctgatcacgcccaacgac
gcgctggaccgctacctgcgcggcgacaagaatgcgctctcgccgcaggccatccgcggc
atggagacctttgagcgcatcggctgcacctcctgccacgccggcccggcgctctccagc
ggtgcgatgatgaagttcgactggggcagcgaccccggcaaggcgagctggaccaacaac
ccgcaggacgagaagttcttccgggtgcagaccctgcgcaacgtctcgctgaccggcccg
tacttccacgacggttcggtggagaccctggaggaggccgtgaccatcatggcccgggtg
cagctcggctacgagctcagcgaccaggagcgggacgacatcgtcgccttcctgcggtcc
ctggtgggcgagatgccccaggtcgaggtgccggtgctgccggccgaatag

DBGET integrated database retrieval system