KEGG   Symbiobacterium thermophilum: STH2049Help
Entry
STH2049           CDS       T00196                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sth  Symbiobacterium thermophilum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STH2049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH2049
  Lipid metabolism
   00071 Fatty acid degradation
    STH2049
  Amino acid metabolism
   00350 Tyrosine metabolism
    STH2049
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STH2049
   00626 Naphthalene degradation
    STH2049
Enzymes [BR:sth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STH2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2186723..2187907
Genome map
AA seq 394 aa AA seqDB search
MLPRYYEFYNPVKVLSGEHALENLPYEMAHLHAKRPILLTNQQLVEVGLTRILQDALRGS
DLTIAAQYTEIPQDSSIHVVNAAGRVFREAGCDSIIALGGGSVIDTAKGLRVLIGQETDD
IMQYMGADILQPKRRVPLAVVPTTAGTGSEATLVAVIAHPERQVKMEFVSHHLLPDLAVL
DPRMTRSLPPRITASTGMDALVHAIEGYTSIQRNPLSDAYAWAAIELIREYLPRAVANGQ
DTEARLAMANAALMAGAAFSNAMVGLVHAIGHAVGGVARVAHGDAMAILLPHVMEYNLDM
LSDRYGRLLLALAGPEVYAATPDNVRGSQAIAVVRAFAERLHQACGLPLRLRDVGVTEAQ
LPAIARTTMNDGALLMNAKEAGPDDVMQILRKAF
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgcttccgcggtattatgagttctacaatccggtcaaggtgctctcgggcgaacacgcc
ctcgagaacctgccctatgagatggctcatctccatgcgaagcgccccatcctcctcacc
aatcagcagctggtggaagtggggctcacacgcatcctgcaggacgcgctgcggggttcg
gacctgaccatcgccgcacagtacacggagatcccccaggactcgtcgatccacgtggtc
aacgccgccggccgggtcttccgggaagccggctgcgactcgatcatcgccctgggcggc
ggctcggtcatcgacaccgccaaggggctgcgggtgctgatcggccaggagaccgacgac
atcatgcagtacatgggcgcggacatcctgcagccgaagcggcgcgtgcccctggccgtg
gtgcccaccaccgccggcacgggctcggaggccaccctggtggcggtcatcgcccacccg
gagcggcaggtgaagatggagttcgtctcccaccacctgctgccggacctggccgtgctc
gacccacgcatgacccgctcgctgccgccccgcatcacggcttccacgggcatggacgcg
ctggtgcacgcgatcgagggctacacctcgatccagcggaacccgctcagcgacgcctat
gcctgggcggccatcgagctgatccgggagtacctgccccgggcggtggcgaacggccag
gacaccgaggcccgcctcgccatggccaacgcggccctcatggccggcgccgccttctcc
aacgccatggtggggctggtccatgccatcggccatgcggtgggcggcgtggcccgggtc
gcgcacggcgacgccatggcgattctgctgccccacgtcatggagtataacctcgacatg
ctgagcgaccggtacggccgcctgctcctggccctggccggacccgaggtctatgcggcg
actccggacaacgtgcgcggctcccaggccatcgcggtggtgcgggccttcgccgagcgg
ctccaccaggcgtgcggcctccccctccgcctccgggacgtgggcgtcaccgaggcccag
ctgcccgccatcgcccgcacgaccatgaacgacggcgccctgctgatgaacgccaaggag
gcgggtccggacgacgtgatgcagatcctccggaaggccttctga

DBGET integrated database retrieval system