KEGG   Symbiobacterium thermophilum: STH212Help
Entry
STH212            CDS       T00196                                 

Definition
enoyl-CoA hydratase/isomerase family protein
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sth  Symbiobacterium thermophilum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    STH212
  Carbohydrate metabolism
   00640 Propanoate metabolism
    STH212
   00650 Butanoate metabolism
    STH212
  Lipid metabolism
   00071 Fatty acid degradation
    STH212
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STH212
   00310 Lysine degradation
    STH212
   00360 Phenylalanine metabolism
    STH212
   00380 Tryptophan metabolism
    STH212
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STH212
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STH212
   00281 Geraniol degradation
    STH212
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STH212
   00627 Aminobenzoate degradation
    STH212
   00930 Caprolactam degradation
    STH212
Enzymes [BR:sth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STH212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236506..237279
Genome map
AA seq 257 aa AA seqDB search
MAYENILVFREGAVGRVQLNRPQALNALNFRLMTELVEAFREMERDPGIGCLLLHGNEKA
FAAGADIKEMAELGAIDMYTRDYIELWDEVARIKKPIVAAVSGYCLGGGLELAMICDIIV
ASETAKFGQPEINIGVLPGAGGTQRLTRAVGKSLAMEMVLTGRMLTAQEALAAGLVSRVV
PVEVYLSEAQKLAGEIASKSPVALRLAKEAVLQAFEGSLSSGLAYERRLFAMAFASEDQK
EGMRAFTEKRKPEWKGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtacgagaacatcctggtctttcgtgagggagctgtcggccgggtgcagctgaac
cgcccccaggcgctcaacgccctcaacttccgcctgatgacggagctggtggaggcgttc
cgggagatggagcgcgatccgggcatcgggtgcctcctgctgcacggcaatgagaaggcc
ttcgccgccggcgccgacatcaaggagatggcggagctgggcgcaatcgacatgtacacc
cgggactacatcgaactctgggatgaagtcgcccgcatcaagaagcccatcgtcgctgcc
gtcagcggctactgcctgggcggcggcctggagctggcgatgatctgcgacatcatcgtc
gcctcggagacggcgaagttcggccagccggagatcaacatcggcgtcctgccgggcgcc
ggcggcacccagcggctcacccgggcggtcgggaagtcgctggcgatggagatggtcctg
accggccggatgctcaccgcgcaggaggccctggcggccggtctggtcagtcgggtggtt
ccggtggaggtctacctcagcgaggcgcagaagctggccggcgagatcgcgtccaagtcg
cccgtggccctgcggctggccaaggaggcggtgctgcaggccttcgagggcagcctgagc
agcggactcgcgtacgagcgccggctgttcgccatggcttttgcctccgaggaccagaag
gagggcatgcgggccttcaccgagaagcggaagcccgagtggaaggggaggtaa

DBGET integrated database retrieval system